Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR428 IGR425 IGR432 IGR435 IGR430 IGR426 IGR434 IGR427 IGR424 IGR431 IGR422 IGR433 IGR423 IGR429 IGR437 IGR436 rs17, - CT519 rs19, - CT524 rl24, - CT517 rl22, - CT523 rl23, - CT526 rl14, - CT518 rl18, - CT513 rs8, - CT515 rl16, - CT521 rl5, - CT516 rl6, - CT514 rl3, - CT528 rl4, - CT527 rs3, - CT522 rl2, - CT525 CT529 fmt, - CT530 rs17, - CT519 rs19, - CT524 rl24, - CT517 rl22, - CT523 rl23, - CT526 rl14, - CT518 rl18, - CT513 rs8, - CT515 rl16, - CT521 rl5, - CT516 rl6, - CT514 rl3, - CT528 rl4, - CT527 rs3, - CT522 rl2, - CT525 CT529 fmt, - CT530 rl22, - CT523 rl23, - CT526 rl14, - CT518 rs8, - CT515 rl5, - CT516 rl6, - CT514 rl3, - CT528 rl4, - CT527 rs3, - CT522 rl2, - CT525 CT529 fmt, - CT530 rl29, - CT520 lpxA, - CT531 lpxA, - CT531 rl16, - CT521 rs17, - CT519 rs19, - CT524 rl24, - CT517 rl18, - CT513 rl29, - CT520
* Calculated from Protein Sequence

Gene ID: CT525

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl2  

Definition:
50S ribosomal protein L2

Gene Start:
594626

Gene Stop:
593775

Gene Length:
852

Molecular Weight*:
31460

pI*:
11.32

Net Charge*:
36.68

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
In E.coli the L2 protein binds 23S RNA and has peptidyltransferase activity.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to L2 sequences, e.g. residues 4-284 are
51% similar to RL2_ECOLI. CT525 is similar to TP0192 in T.pallidum and to
MG154 in M.genitalium.

CT525 is orthologously related to CPn0644 and
they share 87% similarity.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0090
COG name: Ribosomal protein L2
Functional Class:  J
The phylogenetic pattern of COG0090 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 229-246 are significantly matched to block BL00467, which encompasses
L2 sequences, e.g. RL2_ACTAC.

ProDom Summary:  Protein Domain Search
Residues 76-240 are 62% similar to a L2 domain as observed in RL2_YERPS.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 53 to 129 (E-value = 3e-43) place CT525 in the Ribosomal_L2 family which is described as Ribosomal Proteins L2, RNA binding domain (PF00181)
Residues 135 to 262 (E-value = 1.5e-80) place CT525 in the Ribosomal_L2_C family which is described as Ribosomal Proteins L2, C-terminal domain (PF03947)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
85

PDB Hit:
none

Gene Protein Sequence:
MFKKFKPVTPGTRQLILPSFDELTTQGELKGSSSRRSVRPNKKLSFFKKS
SGGRDNLGHISCRHRGGGVRRHYRVIDFKRNKDGIEAKVASVEYDPNRSA
YIALLNYVDGEKRYILAPKGIKRGDRVISGEGSPFKTGCCMTLKSIPLGL
SVHNVEMRPGSGGKLVRSAGLSAQIIAKTAGYVTLKMPSGEFRMLNEMCR
ATVGEVSNADHNLCVDGKAGRRRWKGIRPTVRGTAMNPVDHPHGGGEGRH
NGYISQTPWGKVTKGLKTRDKRKSNKWIVKDRRK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAAAAAGTTTAAGCCAGTAACTCCCGGGACGAGACAGTTAATTCT
GCCTTCTTTTGATGAGCTTACTACTCAAGGAGAGTTAAAGGGATCTAGTT
CTAGAAGAAGTGTTCGTCCAAATAAAAAGCTTTCTTTTTTCAAAAAGAGC
TCTGGAGGACGAGATAATTTAGGACATATTTCCTGCCGCCATCGTGGAGG
AGGAGTAAGACGTCATTATAGAGTGATCGACTTCAAACGTAATAAAGACG
GTATTGAAGCGAAGGTTGCTTCTGTGGAGTATGATCCAAACCGTTCTGCT
TATATTGCTCTATTGAATTATGTAGATGGAGAAAAGCGTTATATTCTAGC
TCCTAAAGGAATTAAGCGAGGCGATCGTGTGATTTCTGGAGAAGGAAGTC
CTTTCAAAACTGGATGCTGCATGACTCTTAAGAGCATCCCTCTGGGACTT
TCTGTTCATAACGTGGAGATGAGACCTGGCTCCGGGGGTAAATTAGTCCG
TTCTGCAGGACTTTCAGCCCAGATCATCGCTAAAACAGCTGGATACGTCA
CTTTGAAGATGCCTTCTGGCGAATTTCGTATGTTGAATGAAATGTGCCGA
GCTACTGTCGGAGAGGTCTCCAATGCAGATCACAATCTGTGTGTAGACGG
TAAAGCTGGGCGTCGTCGATGGAAAGGAATTCGGCCAACAGTTCGAGGAA
CAGCTATGAACCCTGTTGATCACCCACACGGAGGTGGTGAAGGGCGTCAT
AACGGATACATTTCCCAGACCCCTTGGGGTAAAGTCACGAAAGGATTGAA
AACTCGTGATAAGCGTAAGAGTAATAAGTGGATAGTTAAGGATAGAAGGA
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy