Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 IGR416 IGR414 IGR411 IGR417 IGR415 IGR409 IGR412 IGR410 IGR413 IGR408 rs11, - CT508 ndk, - CT500 rl17, - CT506 ruvC, - CT502 CT503 ruvA, - CT501 CT504 gap, - CT505 rpoA, - CT507 dnaB, - CT497 gidA, - CT498 rs11, - CT508 ndk, - CT500 rl17, - CT506 ruvC, - CT502 CT503 ruvA, - CT501 CT504 gap, - CT505 rpoA, - CT507 dnaB, - CT497 gidA, - CT498 rs11, - CT508 ndk, - CT500 rl17, - CT506 ruvC, - CT502 CT503 ruvA, - CT501 CT504 gap, - CT505 rpoA, - CT507 dnaB, - CT497 gidA, - CT498 lplA, - CT499 lplA, - CT499
* Calculated from Protein Sequence

Gene ID: CT502

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ruvC  

Definition:
Holliday junction endodeoxyribonuclease

Gene Start:
581240

Gene Stop:
580731

Gene Length:
510

Molecular Weight*:
18699

pI*:
9.85

Net Charge*:
6.58

EC:
3.1.22.4  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Secondary Evidence:
West,S.C. 1997. Processing of recombination intermediates by the RuvABC proteins. Annu. Rev. Genet. 31: 213-244. Medline: 98105106.

Sharples,G.J. and Lloyd,R.G. 1991. Resolution of Holliday junctions in Escherichia coli: identification of the ruvC gene product as a 19-kilodalton protein. J. Bacteriol. 173(23): 7711-7715. Medline: 92041688.

Takahagi,M., Iwasaki,H., Nakata,A. and Shinagawa,H. 1991. Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease. J. Bacteriol. 173(18): 5747-5753. Medline: 91358366.

Shinagawa,H., Makino,K., Amemura,M., Kimura,S., Iwasaki,H. and Nakata,A. 1988. Structure and regulation of the Escherichia coli ruv operon involved in DNA repair and recombination. J. Bacteriol. 170(9): 4322-4329. Medline: 88314937.

Comment:
This nuclease, also called a resolvase, cleaves cruciform structures (Holliday junction intermediates) in supercoiled DNA, and in so doing, leaves a 5' phosphate and a 3' hydroxyl group. It is a crossover junction endonuclease, typically a homodimer. Magnesium is supposed to be a cofactor. See RuvA (CT501) and RuvB (CT040).



Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to RUVC sequences, e.g. residues
4-158 are 38% similar to RUVC_HAEIN. Psi-BLAST does not elicit
orthologs other than RuvC sequences. .

CT502 is orthologously related to CPn0621:residues 1-160 are 60% similar to that of CPn0621. CT502 is similar to TP0517 in T.
pallidum, a predicted RuvC protein. No similarity to M. genitalium

COGS Summary:  COGS Search
BeTs to 8 clades of COG0817
COG name: Holliday junction endodeoxyribonuclease RuvC
Functional Class:  L
The phylogenetic pattern of COG0817 is ------vce-rhuj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 6-19, 64-80, 86-102, 110-129, 144-156, 146-158 are significantly
matched to blocks PR00696A-E, which encompass crossover
junction endonucleases, e.g. RUVC_ECOLI, RUVC_MYCLE, PSEASPS2.

ProDom Summary:  Protein Domain Search
Residues 47-135 are 40% similar to a Holliday junction nuclease domain
as observed in RUVC_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 5 to 156 (E-value = 2.6e-66) place CT502 in the RuvC family which is described as Crossover junction endodeoxyribonuclease RuvC (PF02075)

PDB Hit:
gi|999741|pdb|1HJR|A Chain A, Holliday Junction Resolvase (E.C.3.1.22.4) (Ruvc)

Gene Protein Sequence:
MADLIMGIDPGTLVCGYALIKVENRYHIHPHSFGKVKLSQKLALAHRYKQ
LFTEISTILQQESPKAVVLETQYVHKNPQSTIKLGMARGVLLLAASLQDV
PVFEYAPNTAKKAAVGKGNASKKQVQLMVSKLLRVPDLLAEDNEDIADAF
ALAMCHAHLAPYQDLKKTLV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGATTTGATCATGGGGATAGATCCAGGAACGTTAGTTTGTGGATA
CGCGTTGATTAAGGTAGAAAATCGATATCACATTCACCCACATAGTTTTG
GAAAGGTTAAGCTCTCTCAGAAGTTAGCTTTGGCTCATCGTTATAAACAG
TTGTTTACAGAGATTTCCACAATTCTTCAACAAGAGTCTCCTAAAGCTGT
TGTTTTAGAGACGCAGTACGTCCATAAAAATCCCCAAAGTACCATTAAGC
TGGGAATGGCTAGAGGTGTTTTATTATTAGCGGCATCTTTACAGGATGTC
CCTGTATTTGAATACGCTCCCAATACGGCTAAAAAAGCTGCTGTGGGTAA
AGGCAATGCTTCTAAGAAGCAGGTACAGTTAATGGTGAGCAAATTATTGC
GTGTTCCAGATCTTTTAGCAGAAGATAATGAGGATATAGCGGATGCCTTT
GCTTTAGCCATGTGCCACGCACATCTCGCTCCTTATCAGGATTTAAAGAA
GACTCTTGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy