Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-3 tRNA-Ser-3 IGR416 IGR414 IGR411 IGR415 IGR409 IGR412 IGR410 IGR413 IGR408 IGR007 CT496.1 ndk, - CT500 rl17, - CT506 ruvC, - CT502 CT503 ruvA, - CT501 CT504 gap, - CT505 rpoA, - CT507 dnaB, - CT497 gidA, - CT498 CT496.1 ndk, - CT500 rl17, - CT506 ruvC, - CT502 CT503 ruvA, - CT501 CT504 gap, - CT505 rpoA, - CT507 dnaB, - CT497 gidA, - CT498 CT496.1 ndk, - CT500 ruvC, - CT502 CT503 ruvA, - CT501 CT504 gap, - CT505 rpoA, - CT507 rl17, - CT506 dnaB, - CT497 gidA, - CT498 lplA, - CT499 lplA, - CT499
* Calculated from Protein Sequence

Gene ID: CT500

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ndk  

Definition:
nucleoside diphosphate kinase

Gene Start:
579946

Gene Stop:
579524

Gene Length:
423

Molecular Weight*:
15307

pI*:
5.09

Net Charge*:
-5.04

EC:
2.7.4.6  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; purines, pyrimidines  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
This enzyme catalyzes the synthesis of nucleoside triphosphates
other than ATP. ATP is added to the nucleoside diphosphate.
The molecule is known in some cases to be a homotetramer.

From Prosite PDOC00409:

Nucleoside diphosphate kinases (EC 2.7.4.6) (NDK) are enzymes required for the synthesis of nucleoside triphosphates (NTP) other than ATP. They provide NTPs for nucleic acid synthesis, CTP for lipid synthesis, UTP for polysaccharide synthesis and GTP for protein elongation, signal transduction and microtubule polymerization.

In eukaryotes, there seems to be a small family of NDK isozymes each of which acts in a different subcellular compartment and/or has a distinct biological function. Eukaryotic NDK isozymes are hexamers of two highly related chains (A and B). By random association (A6, A5B...AB5, B6), these two kinds of chain form isoenzymes differing in their isoelectric point.

NDK are proteins of 17 Kd that act via a ping-pong mechanism in which a histidine residue is phosphorylated, by transfer of the terminal phosphate group from ATP. In the presence of magnesium, the phosphoenzyme can transfer its phosphate group to any NDP, to produce an NTP.

NDK isozymes have been sequenced from prokaryotic and eukaryotic sources. It has also been shown that the Drosophila awd (abnormal wing discs) protein, is a microtubule-associated NDK. Mammalian NDK is also known as metastasis inhibition factor nm23.

The sequence of NDK has been highly conserved through evolution. There is a single histidine residue conserved in all known NDK isozymes, which is involved in the catalytic mechanism.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to NDK sequences, e.g. residues
1-136 are 64% similar to NDK_MYXXA and 61% similar to NDK_HELPY. CT500
is similar to TP1010, a predicted nucleoside-diphosphate kinase in
T.pallidum. No similarity to M.genitalium.

CT500 is orthologously related to CPn0619: residues
1-139 are 81% similoar to CPn0619.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0105
COG name: Nucleoside diphosphate kinase
Functional Class:  F
The phylogenetic pattern of COG0105 is amtkyq-cebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 2-36, 46-89, 64-105, 90-131 are significantly
matched to blocks BL00469A,B,C, which encompass nucleoside
diphosphate kinase sequences.

ProDom Summary:  Protein Domain Search
Residues 2-131 are 63% similar to a ND kinase domain as
observed in NDK_HELPY.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis, however residues
36-67 are 48% similar to a stretch of CT577, a hypothetical.

Pfam Summary:  Pfam Search
Residues 2 to 139 (E-value = 4.5e-73) place CT500 in the NDK family which is described as Nucleoside diphosphate kinase (PF00334)

PDB Hit:
gi|494821|pdb|2NCK|R Chain R, Nucleoside Diphosphate Kinase (E.C.2.7.4.6) (Tetragonal Form)

Gene Protein Sequence:
MEQTLSIIKPDSVGKAHIGEIIAIFEKSGLRIAAMKMVHLSVKEAEGFYV
VHKERPFFQELVDFMISGPVVVMVLQGENAVDRNRELMGATNPKEAAEGS
IRALFGESIGVNAVHGSDSLENAAIEVSYFFAKTEIVNSVA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACAAACTCTATCAATTATCAAACCTGATTCTGTAGGCAAGGCTCA
TATAGGGGAAATTATTGCTATTTTTGAAAAATCTGGGCTAAGAATTGCAG
CCATGAAAATGGTTCATCTCTCGGTAAAAGAGGCAGAAGGATTTTATGTT
GTTCATAAAGAGAGACCTTTTTTCCAAGAACTGGTAGACTTTATGATCTC
TGGTCCTGTTGTAGTAATGGTACTGCAAGGGGAAAACGCTGTCGACCGTA
ACAGAGAGTTGATGGGAGCAACGAATCCTAAAGAAGCTGCGGAAGGTTCG
ATTCGAGCTTTATTCGGAGAATCGATAGGAGTAAATGCTGTTCATGGGTC
CGATAGTCTAGAGAATGCTGCTATTGAGGTAAGCTATTTCTTTGCTAAGA
CAGAAATAGTTAACTCTGTAGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy