Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-3 IGR404 IGR411 IGR409 IGR405 IGR410 IGR406 IGR408 IGR007 CT496.1 ndk, - CT500 pgsA, - CT496 ruvC, - CT502 ruvA, - CT501 sohB, - CT494 npt2, - CT495 polA, - CT493 dnaB, - CT497 gidA, - CT498 CT496.1 ndk, - CT500 pgsA, - CT496 ruvC, - CT502 ruvA, - CT501 sohB, - CT494 npt2, - CT495 polA, - CT493 dnaB, - CT497 gidA, - CT498 CT496.1 ndk, - CT500 pgsA, - CT496 ruvA, - CT501 sohB, - CT494 npt2, - CT495 polA, - CT493 ruvC, - CT502 dnaB, - CT497 gidA, - CT498 lplA, - CT499 lplA, - CT499
* Calculated from Protein Sequence

Gene ID: CT497

DNA Molecule Name:
1  

Genbank ID:
3328934

Gene Name:
dnaB  

Definition:
replicative DNA helicase

Gene Start:
575229

Gene Stop:
576644

Gene Length:
1416

Molecular Weight*:
53287

pI*:
6.38

Net Charge*:
-3.78

EC:
3.6.1.-  

Functional Class:
DNA replication and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis

Comment:
In E.coli, the DnaB protein is involved in initiation and elongation
during chromosome replication. It is a homomeric enzyme.

DnaB has also been shown to be found on the 7.5 kb C. trachomatis plasmid. See Comanducci M, Ricci S, Ratti G. 1988. The structure of a plasmid of Chlamydia trachomatis believed to be required for growth within mammalian cells. Mol Microbiol 2(4):531-8. Medline: 2845228, Sriprakash KS, Pearce BJ. 1990. Mapping of transcripts encoded by the plasmid in Chlamydia trachomatis. FEMS Microbiol Lett 59(3):299-303. Medline: 1703100, and Hatt C, Ward ME, Clarke IN. 1988. Analysis of the entire nucleotide sequence of the cryptic plasmid of Chlamydia trachomatis serovar L1. Evidence for involvement in DNA replication. Nucleic Acids Res 16(9):4053-67. Medline: 2836808

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to replicative DNA helicases, e.g. residues
17-464 are 38% similar to DNAC_BACSU. Residues 6-470 are 40% similar
to DNAB_ECOLI. Residues 8-462 are 32% similar to TP0058, a predicted dnaB protein in T.pallidum.
CT497 is also similar to MG094 in M.genitalium. See M19487, X62475,
J03321, X07547 for homologous chlamydial sequences.

CT497 is orthologously related to CPn0616: residues 24-469 are 74% similar to residues 1-446 of CPn0616.

This sequence is also orthologous to PG1098 of P. gingivalis.



COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:  L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 246-400 are 40% similar to a DnaB domain as represented
by DNAC_BACSU. Residues 17-245, 185-430, 216-425, 403-464 support this
observation as evidenced by the similarities to DNAB_HAEIN,
PRIM_BPT7, VG41_BPT4.

Paralogs:  Local Blast Search
CT497 is paralogously related to pCT01, a predicted DNAB-like helicase: residues 175-462 are 38% similar to pGP1-D (a D serovar sequence virtually identical to pCT01). See also the pGP1-D sequence of PLGV440.

Pfam Summary:  Pfam Search
Residues 15 to 117 (E-value = 3.2e-36) place CT497 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 205 to 405 (E-value = 3.1e-122) place CT497 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
324  
418

PDB Hit:
None.

Gene Protein Sequence:
MATQTKKPQPTQLLSLPNSKESEMIVLGCMLTSVNHLNLAANLLQEDDFY
FLEHRIIFRVLQDAFKSDRPMDPHLTGEELKRRDQLNIIGGPSYLITLSE
FAGTSAYIEEYAEIIRSKSILRKMIQAAKDIEKKAAEEPRDVTTALDDAQ
NLLFRISQTTNLAPHVLVADKLKGVASSKDKSFLLALQERQEAFQASAHD
SSSPMLSGFPTHFLDLDKMISGFSPSNLIILAARPAMGKTALALNIVENF
CFDSRLPVGIFSLEMTVDQLIHRIICSRSEVEAKKISVGDISGRDFQRVV
SVVREMEEHTLLIDDYPGLKITDLRARARRMKESYDIQFLVIDYLQLISS
SGNLRNSDSRNQEISEISRMLKNLARELNIPILCLSQLSRKVEDRANHRP
LMSDLRESGSIEQDADQIMFLLRREYYDPNDKPGTAELIVAKNRHGSIGS
VQLVFEKDFARFRNYAGCEFPG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGACCCAGACAAAAAAACCCCAACCCACTCAACTCCTCTCTCTTCC
TAATTCTAAGGAATCTGAAATGATTGTACTGGGGTGTATGTTGACCAGTG
TCAATCATTTGAACCTTGCTGCCAACCTTCTTCAGGAAGATGATTTCTAC
TTCTTAGAGCATCGTATTATTTTTCGTGTGTTGCAGGACGCTTTCAAGTC
TGACCGCCCCATGGATCCCCATCTTACGGGAGAAGAACTCAAACGCCGAG
ATCAACTCAATATCATTGGAGGCCCCTCTTATCTAATCACTCTCTCTGAA
TTTGCAGGGACATCTGCCTATATTGAAGAATACGCAGAAATTATCCGCTC
CAAATCTATTCTAAGAAAAATGATTCAAGCGGCCAAAGATATCGAAAAGA
AAGCCGCTGAAGAGCCACGTGACGTCACTACCGCTTTAGATGATGCTCAA
AACTTATTGTTTCGCATAAGCCAAACAACTAACTTAGCCCCCCATGTCCT
TGTTGCAGACAAACTCAAAGGAGTTGCTTCTTCTAAAGACAAATCCTTCT
TACTCGCTTTACAAGAACGCCAAGAAGCTTTCCAAGCAAGTGCTCATGAC
TCAAGCTCTCCTATGCTCTCAGGCTTCCCCACTCATTTCTTAGATCTAGA
TAAAATGATTAGTGGGTTCAGCCCCTCTAACTTGATCATTCTTGCTGCTC
GTCCTGCTATGGGGAAAACTGCTTTAGCTCTTAACATTGTAGAGAATTTT
TGTTTTGATAGCCGGCTTCCTGTAGGAATTTTTTCATTAGAGATGACTGT
AGACCAGTTAATCCATCGCATCATCTGCTCGCGTTCCGAAGTAGAAGCTA
AAAAAATTAGCGTGGGAGATATTTCTGGTAGAGATTTTCAACGCGTGGTC
TCTGTGGTAAGAGAGATGGAAGAACATACTCTACTCATAGATGACTACCC
GGGATTGAAAATCACAGATCTTCGAGCACGCGCAAGAAGAATGAAAGAAA
GCTACGATATCCAATTTCTAGTTATTGACTACCTACAATTAATCTCTAGC
TCTGGGAACCTAAGAAATTCTGATTCGCGAAACCAAGAAATTTCTGAAAT
CTCCAGAATGCTTAAAAATTTGGCTCGAGAACTCAATATTCCTATTCTCT
GCCTCTCTCAATTATCTAGAAAAGTAGAAGACAGAGCTAATCACAGACCT
TTGATGAGCGATTTAAGAGAAAGTGGAAGCATTGAACAAGATGCTGACCA
AATTATGTTTTTACTTCGCCGCGAATATTATGATCCTAATGATAAACCTG
GAACAGCAGAGTTGATTGTGGCTAAAAACCGCCACGGCTCCATTGGATCT
GTACAATTAGTTTTTGAAAAAGACTTCGCTCGATTCCGAAATTATGCTGG
CTGTGAGTTCCCTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy