Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-3 IGR404 IGR409 IGR405 IGR406 IGR408 IGR007 CT496.1 pgsA, - CT496 sohB, - CT494 npt2, - CT495 polA, - CT493 dnaB, - CT497 gidA, - CT498 CT496.1 pgsA, - CT496 sohB, - CT494 npt2, - CT495 polA, - CT493 dnaB, - CT497 gidA, - CT498 CT496.1 pgsA, - CT496 sohB, - CT494 npt2, - CT495 polA, - CT493 dnaB, - CT497 gidA, - CT498 lplA, - CT499 lplA, - CT499
* Calculated from Protein Sequence

Gene ID: CT496

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgsA  

Definition:
phosphatidylglycerophosphate synthase

Gene Start:
574715

Gene Stop:
574212

Gene Length:
504

Molecular Weight*:
19609

pI*:
8.91

Net Charge*:
4.28

EC:
2.7.8.5  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:
PGSA (phosphatidylglycerophosphate synthase, or CDP-diacyglycerol-
glycerol -3-phosphate) is an integral membrane protein involved
in synthesis of acidic phospholipids. CDP-diacylglycerol-glycerol-3-phosphate
is converted to 3-(3-phosphatidyl)-glycerol 1-phosphate.

Blast Summary:  PSI-Blast Search
A few hits in gapped BLAST to PGSA sequences, e.g. residues
29-133 are 33% similar to PGSA_HAEIN. Psi-BLAST recognizes
phosphatidylserine and phosphatidylinositol synthase sequences
in addition to phosphatidylglycerophosphate synthase sequences. CT496
is similar to MG114, a predicted phosphotidylglycerophosphate synthase
in M.genitalium. A very weak similarity is seen to TP0256 in T.pallidum.

CT496 is orthologous to CPn0615: residues 1-167 are 65% similar to CPn0615.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 38-74 are significantly matched to block BL00379,
which consists of PGSA sequences, e.g. PGSA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 29-77 are 46% similar to PGSA domain as observed in
PGSA_HAEIN. Residues 24-67 are 40% similar to a phosphatidylserine
synthase domain as observed in PSS_BACSU.

Paralogs:  Local Blast Search
CT496 is weakly paralogous to CT797, also thought to be
a CDP-diacylglycerol-glycerol-3-phosphate sequence. Residues
28-133 are 29% similar to CT797.

Pfam Summary:  Pfam Search
Residues 28 to 165 (E-value = 5.2e-27) place CT496 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
16  
39
transmembrane  
66  
100
transmembrane  
119  
153

PDB Hit:
none

Gene Protein Sequence:
MRQFCNLLSLSRVWLALLFCQERIITRLLVIFAAMVSDVLDGYLARRYNA
TSRLGSILDPATDKIFFLICVGVLFWENSLGLTHLALIFSRDIFLVFFGF
YLSWVRGWKGYDYRALSFGKFFTVVQFFILFGMTIGMEMPVLWLAPLVIL
GALYFLERVLDYRRHCLE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGACAATTCTGTAATCTCCTTTCTTTGTCCAGGGTGTGGTTAGCCCT
TCTTTTCTGCCAAGAGAGAATTATAACAAGGTTGTTGGTTATCTTTGCTG
CGATGGTTAGCGATGTTCTAGATGGCTATCTGGCTAGACGCTACAATGCT
ACAAGTCGCTTGGGCTCCATTCTTGACCCTGCCACAGATAAAATATTTTT
TTTAATCTGTGTGGGGGTTCTATTTTGGGAAAACTCTCTAGGGCTTACGC
ACCTCGCTCTGATTTTTTCTAGAGATATTTTTTTAGTGTTCTTCGGGTTC
TATCTATCCTGGGTTCGAGGATGGAAGGGATATGATTACAGAGCATTGTC
TTTTGGAAAGTTTTTTACAGTTGTTCAATTCTTTATTTTATTTGGGATGA
CGATAGGGATGGAGATGCCAGTTCTTTGGTTAGCTCCCTTAGTGATCCTC
GGGGCTCTCTACTTTTTAGAGAGAGTTTTGGATTATAGGCGGCACTGTTT
GGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy