Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR403 IGR399 IGR400 IGR401 IGR398 IGR402 CT487 CT488 fliY, - CT486 hemZ, - CT485 CT484 glgC, - CT489 rho, - CT491 polA, - CT493 CT490 CT483 CT487 CT488 fliY, - CT486 hemZ, - CT485 CT484 glgC, - CT489 rho, - CT491 polA, - CT493 CT490 CT483 CT487 CT488 fliY, - CT486 hemZ, - CT485 CT484 glgC, - CT489 rho, - CT491 polA, - CT493 CT492 CT492 CT490 CT483
* Calculated from Protein Sequence

Gene ID: CT489

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgC  

Definition:
ADP-glucose pyrophosphorylase

Gene Start:
566177

Gene Stop:
564855

Gene Length:
1323

Molecular Weight*:
49852

pI*:
6.82

Net Charge*:
-1.28

EC:
2.7.7.27  

Functional Class:
energy metabolism; starch and sucrose metabolism  

Pathway: pathway table
Starch and sucrose metabolism

Comment:
This protein is typically seen in plants where it contributes to starch formation by converting alpha-D-glucose-1-phosphate to ADP-glucose. No hits to bacterial sequences, only plant (note weak BLAST scores with COG Summary).

From Prosite PDOC00638:

ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) (EC 2.7.7.27) catalyzes a very important step in the biosynthesis of alpha 1,4-glucans (glycogen or starch) in bacteria and plants: synthesis of the activated glucosyl donor, ADP-glucose, from glucose-1-phosphate and ATP.

ADP-glucose pyrophosphorylase is a tetrameric allosterically regulated enzyme. It is a homotetramer in bacteria while in plant chloroplasts and amyloplasts, it is a heterotetramer of two different, yet evolutionary related, subunits.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glucose-1-phosphate adenyltransferase sequences, e.g. residues
26-440 are 37% similar to GLGC_ANASP. Majority of hits are to plant enzymes. Residues
26-440 are 34% similar to the ADP-glucose pyrophosphorylase from Synechocystis (M83556).
No similarity to T.pallidum or M.genitalium.
CT489 is orthologously related to CPn0607: residues 9-441 are 70% similar to CPn0607.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0448
COG name: ADP-glucose pyrophosphorylase
Functional Class:  G
The phylogenetic pattern of COG0448 is ------VceBrh------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 25-402 span thirteen regions of similarity to blocks BL00808A-J,
which encompass ADP-glucose pyrophosphorylase sequences.

ProDom Summary:  Protein Domain Search
Residues 26-294 are 43% similar to a pyrophosphorylase domain of GLGC_ANASP.
Residues 36-165, 229-289, 302-404 are also similar to GLGD domains as seen
in GLGS_ORYSA and GLGD_BACST.


Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 24 to 294 (E-value = 1.1e-49) place CT489 in the NTP_transferase family which is described as Nucleotidyl transferase (PF00483)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
61  
81
non-globular  
307  
388

PDB Hit:
none

Gene Protein Sequence:
MAGRRTKEEQINRKRSHFYRDNVGVIVLCGGEGKRLSPLTCWRCKPTVSF
GGRYKLIDVPISHAFASGFSKIFVIGQYLTYTLQQHLFKTYFYHGVMQDQ
IHLLVPERRDGSQVWYQGTADAIRQNLLYLQDSRVEYFLILSGDQLYNMD
FRSIVDYAIDAQADMVIASQPVSDKDVSRFGVLKVDDESKLIDFYEKPQS
EEILKHFRLSNTAMKKFGLDPQHGNFLGSMGIYLFRKDCLFQLLLEETGD
DFGKELIHRQMHRGKTVAYLYDGYWTDIGTIESYYEANMALTQRPSHNIR
GFNCYDDGGIIYSKNNHLPGAIISDSRISSSLLCEGAMIESGQVSNSVVG
VRGVIGQGSVFDRSIMMGSDSYGSESFPLGIGKNCEIHKTIIDENCCIGN
GVRLQNLQGHKDYDSPDGKLVVRDGIIIVPRGTQIPDNYVF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGGTAGACGGACGAAAGAAGAGCAGATCAATCGAAAACGATCGCA
TTTCTATCGAGATAACGTAGGAGTTATTGTCTTATGCGGAGGAGAGGGGA
AACGATTATCTCCGTTAACTTGTTGGCGTTGTAAGCCAACAGTATCTTTT
GGGGGAAGATACAAGCTTATTGATGTGCCTATATCTCATGCCTTTGCCTC
AGGATTTTCCAAGATTTTTGTTATCGGGCAATACCTTACCTATACTTTAC
AGCAACACTTATTTAAGACGTATTTTTACCATGGAGTCATGCAGGATCAG
ATTCATCTCTTGGTCCCTGAAAGACGAGATGGAAGTCAGGTTTGGTATCA
GGGAACAGCTGATGCAATTCGCCAAAATCTTCTTTATCTACAAGATTCTC
GTGTAGAGTATTTTTTAATCTTGTCAGGTGACCAACTATACAATATGGAT
TTTCGCTCGATAGTAGATTATGCTATCGATGCACAGGCGGATATGGTGAT
CGCTTCTCAGCCTGTATCAGATAAAGATGTTTCACGATTCGGAGTGTTGA
AAGTAGACGATGAGTCGAAACTGATTGATTTCTATGAGAAACCTCAAAGT
GAAGAGATTTTGAAACATTTTCGTCTAAGTAACACGGCGATGAAAAAATT
TGGTCTCGATCCTCAGCACGGGAATTTTCTAGGATCTATGGGGATTTATC
TTTTCCGTAAAGATTGTCTCTTCCAATTGCTTCTAGAAGAAACTGGAGAT
GATTTTGGGAAAGAGCTGATTCATAGACAAATGCATCGCGGGAAAACTGT
TGCATATCTGTACGACGGTTATTGGACAGATATCGGGACTATAGAATCTT
ATTACGAAGCTAATATGGCTTTGACTCAACGGCCTTCGCACAATATTCGT
GGGTTTAATTGTTATGATGACGGGGGGATAATCTATAGTAAAAATAATCA
TCTTCCTGGAGCAATTATTTCAGATTCGAGAATTTCGAGTTCTTTACTGT
GTGAAGGAGCTATGATTGAGTCTGGCCAGGTCTCGAATAGTGTCGTTGGA
GTTCGAGGGGTAATAGGCCAAGGATCTGTGTTTGACCGTTCTATCATGAT
GGGAAGCGATTCGTATGGTTCTGAGTCTTTCCCTTTAGGGATTGGGAAAA
ACTGTGAAATTCATAAAACCATTATTGATGAAAACTGCTGTATAGGAAAC
GGTGTGCGTTTACAGAATCTGCAGGGGCATAAGGATTATGATTCTCCAGA
TGGGAAATTAGTTGTTCGAGATGGTATTATCATCGTTCCTAGAGGAACGC
AAATCCCAGATAATTACGTATTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy