Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR403 IGR399 IGR400 IGR401 IGR398 IGR396 IGR402 IGR397 CT480.1 CT487 CT482 CT481 CT488 fliY, - CT486 hemZ, - CT485 CT484 glgC, - CT489 rho, - CT491 dppA, - CT480 CT490 CT483 CT480.1 CT487 CT482 CT481 CT488 fliY, - CT486 hemZ, - CT485 CT484 glgC, - CT489 rho, - CT491 dppA, - CT480 CT490 CT483 CT487 CT482 CT481 CT488 fliY, - CT486 hemZ, - CT485 CT484 glgC, - CT489 rho, - CT491 dppA, - CT480 CT480.1 CT490 CT483
* Calculated from Protein Sequence

Gene ID: CT485

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemZ  

Definition:
ferrochelatase

Gene Start:
562607

Gene Stop:
561666

Gene Length:
942

Molecular Weight*:
35496

pI*:
8.12

Net Charge*:
4.89

EC:
4.99.1.1  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Comment:
In Synechocystis, this protein completes protoheme biosynthesis: iron is added to protoporphyrin to form protoheme.

From Prosite PDOC00462:

Ferrochelatase (EC 4.99.1.1) (protoheme ferro-lyase) catalyzes the last step in heme biosynthesis: the chelation of a ferrous ion to proto-porphyrin IX, to form protoheme.

In eukaryotes, ferrochelatase is a mitochondrial protein bound to the inner membrane, whose active site faces the mitochondrial matrix. The mature form of eukaryotic ferrochelatase is composed of about 360 amino acids. In bacteria, ferrochelatase (gene hemH) is a protein of from 310 to 380 amino acids.

The human autosomal dominant disease protoporphyria is due to the reduced activity of ferrochelatase.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ferrochelatase sequences, e.g. residues
3-313 are 28% similar to HEMZ_HUMAN. Residues 2-303 are 31% similar to HEMZ_SYNY3.
No similarities to T.pallidum or M.genitalium.

CT485 is orthologous to CPn0603: residues 4-302 are 55% similar to CPn0603.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0276
COG name: Protoheme ferro-lyase (ferrochelatase)
Functional Class:  H
The phylogenetic pattern of COG0276 is ----yq-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 1-13, 44-68, 223-251, 119-128, 178-212, 218-234, 252-263 are
significantly matched to blocks BL00534A-G, which encompass ferrochelatase
sequences, e.g. HEMZ_CUCSA, HEMZ_ARATH, HEMZ_HELPY, HEMZ_RHOCA.

ProDom Summary:  Protein Domain Search
Residues 17-275 are 32% similar to a ferrochelatase domain as observed in HEMZ_MOUSE.
Residues 227-299 are consistent with this, as evidenced by the similarity
to HEMZ_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 303 (E-value = 1.9e-147) place CT485 in the Ferrochelatase family which is described as Ferrochelatase (PF00762)

PDB Hit:
gi|2781160|pdb|1AK1| Ferrochelatase From Bacillus Subtilis Protoheme Ferro-Lyase, Heme Synthesis, Porphyrin, Metallation, B. Subtilis Mol_id: 1; Molecule: Ferrochelatase; Chain: Null; Synonym: Protoheme Ferro-Lyase; Ec: 4.99.1.1; Engineered: Yes

Gene Protein Sequence:
MVTYLLANFGGPRTSQEIVSFLQALLTDRDVTGGMIPSMLHRPLFSYIAK
RRAPHVARQYAYLGGGSPIFQDTERLAQNLSQELQASVIPFHRYLPETHR
ETLQALQESQGSIVGIPLFPHYTFAVTGSIIRFFLQHLPEKPISWITQFG
VHPEFVSCMQQHIRDCLAAQQIAVEDCYFLFSVHGLPQRHIRLGDPYAQQ
CQASFEALRGELEGKIAFQSKFGIGKWLDPSTQEVCQSLRTKKRYIVIVP
FGFVSDHIETLHEIDHLYVPILLQKGYRVVRIPAINASSRWVSSLAAIVR
SSPQETSLEPLLMP

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTAACATATTTACTAGCCAATTTTGGAGGTCCAAGGACTTCTCAGGA
GATTGTCAGCTTTCTACAAGCTCTATTGACAGATCGAGATGTTACAGGAG
GAATGATTCCTTCCATGTTGCATAGGCCATTGTTTTCTTATATTGCTAAG
CGTCGAGCTCCTCATGTAGCGCGACAATACGCTTATTTAGGAGGGGGATC
TCCTATTTTTCAAGATACAGAGAGACTAGCTCAAAACCTCTCTCAAGAAT
TGCAAGCTTCAGTTATTCCTTTTCATAGATATTTACCAGAGACTCACCGG
GAAACCTTACAGGCATTACAAGAAAGCCAGGGAAGCATAGTTGGGATTCC
ATTATTCCCACATTACACCTTCGCAGTAACAGGGAGTATAATTCGATTTT
TCTTACAACATCTTCCAGAAAAACCCATTTCTTGGATTACGCAGTTTGGA
GTGCATCCTGAGTTTGTCTCGTGTATGCAACAGCATATTCGAGACTGTTT
AGCCGCTCAGCAGATCGCTGTGGAGGATTGCTATTTTCTTTTTTCTGTAC
ACGGATTACCTCAAAGGCATATTCGTTTAGGAGATCCTTATGCTCAGCAA
TGTCAGGCTTCTTTCGAAGCATTACGAGGTGAATTAGAGGGGAAAATTGC
TTTTCAATCTAAGTTTGGGATTGGAAAATGGCTAGATCCCTCTACTCAAG
AGGTCTGTCAGTCTTTGCGTACCAAGAAACGCTACATTGTGATTGTCCCT
TTTGGATTTGTTTCGGATCATATTGAGACTCTACATGAAATAGATCATCT
GTATGTGCCTATATTGCTGCAAAAGGGGTATCGTGTGGTTCGTATCCCAG
CTATCAATGCTTCTTCTAGATGGGTATCCTCTCTAGCAGCAATAGTCAGA
AGTTCCCCACAGGAAACTTCTTTAGAGCCGCTTCTAATGCCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy