Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-2 IGR393 IGR388 IGR394 IGR391 IGR390 IGR392 IGR389 CT471 CT474 oppB, - CT479 oppC, - CT478 CT473 CT477 CT470 CT472 CT476 pheT, - CT475 CT471 CT474 oppB, - CT479 oppC, - CT478 CT473 CT477 CT470 CT472 CT476 pheT, - CT475 CT471 CT474 oppB, - CT479 oppC, - CT478 CT473 CT477 CT470 CT472 CT476 pheT, - CT475
* Calculated from Protein Sequence

Gene ID: CT475

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pheT  

Definition:
phenylalanyl-tRNA synthetase beta subunit

Gene Start:
548392

Gene Stop:
550761

Gene Length:
2370

Molecular Weight*:
87088

pI*:
6.28

Net Charge*:
-8.87

EC:
6.1.1.20  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
In B.subtilis, the phe-tRNA synthetase is a tetramer composed of two alpha and
two beta subunits. See CT836 for the alpha chain sequence.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phenylalanyl-tRNA synthetase beta chain sequences,
e.g. residues 27-779 are 29% similar to SYFB_BACSU. CT475 is
similar to TP0015 of T.pallidum and MG195 of M.genitalium.

This sequence is also orthologous to PG86 of P. gingivalis.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0072
COG name: Phenylalanyl-tRNA synthetase beta subunit
Functional Class:  J
The phylogenetic pattern of COG0072 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 363-774 are 26% similar to a phe-tRNA synthetase beta chain domain
as observed in SYFB_BACSU. Residues 20-184, 72-150, 162-231, 233-361 support
this assignment through similarities to SYFB_HELPY, SYFB_HAEIN, SYFB_ECOLI.
Residues 49-127 are similar to a domain of the met-tRNA synthetase, as
seen in SYM_THETH.


Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 45 to 152 (E-value = 2.7e-35) place CT475 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)
Residues 155 to 299 (E-value = 6.7e-43) place CT475 in the B3_4 family which is described as B3/4 domain (PF03483)
Residues 406 to 474 (E-value = 1.2e-24) place CT475 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)
Residues 694 to 787 (E-value = 1.3e-38) place CT475 in the FDX-ACB family which is described as Ferredoxin-fold anticodon binding domain (PF03147)

PDB Hit:
gi|2781286|pdb|1PYS|B Chain B, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Phenylalanyl-Trna Synthetase, Class Ii Aminoacyl-Trna Synthetase, Thermus Thermophilus, Rbd Domain, Sh3 Domain, Helix-Turn-Helix Motif Mol_id: 1; Molecule: Phenylalanyl-

Gene Protein Sequence:
MLVPLSLLQKFFSSPLSIEEILQACDRIGIEAECSNVFPDSLNTVVTGKI
LSASPHPDAERLTVAIVFDGKGERQIICGAPNCRAGIIVPIALPGAKLRN
ASGEITTIKKAKIRGLESQGMCCGADELGFPHLQKAERGIFEFPADTPLG
ESACMLLAGAPLECSLTPNLGHCASLLGLAREISFLSPVSLNIPEEFSFA
SLPQETSICDMHDAGACPVFYSVKISGLSCRRSPEYLQAALTALGQKPLN
AIVDITNYVMLSLGQPLHAYDSQAVEQKSLHAATLQSAQPLTLLNQETYT
LPAGSLVVADQHNILGLAGVMGSAASSCSENTTEIILEAAYFQPQAVRKY
QRTIQLHTEAAYRFTRGVDPQGVLPVLHAAIHMIQSLFPDAQISPIQKIG
DDSFSPLSLSVRPKTIKRLLDIELSTAEIVAKLSSLGFQTAVEEQAVRVE
VPSYRHDIQEETDLVEEICRTTPFVQKTQKILPTYTPIYSLKRELTAFLA
NGGLQQFFTYSLLDTEVSSLSLQESSLIPVQNSSWKLRDSLLPGMLKSAA
TNLHRQAPYVYAFEIGNVYSKEQNRYQEEERVAILLSRQVMDDSWQGKTP
LSFYTIKGWVEKLLCQSGASIEDFSLQPSQHPNFHPYQQAALYQKKHLLG
IFGTLHPQLCRKAQIKHDVVFAELSLNVLLSLKKKSGPHYVPYPIYPASS
RDITITIDRDLPADLVRRELLSFESKWLESVHIVSVYQGRDSASQSKNVS
LRMVFRDHERTLSGQEIEEEYERLTALLDKKLANIGQGNS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCGTTCCTTTATCCCTATTACAAAAATTCTTCTCTTCTCCTCTCTC
TATTGAGGAAATTTTACAAGCCTGTGATCGTATTGGAATCGAAGCGGAAT
GCTCAAATGTTTTTCCGGATTCCCTTAATACTGTTGTAACAGGGAAAATT
TTAAGTGCCTCTCCTCATCCTGATGCAGAAAGACTTACTGTTGCCATCGT
TTTTGACGGGAAGGGTGAGCGCCAAATCATCTGTGGAGCTCCCAACTGCC
GAGCAGGCATCATTGTTCCTATAGCCTTACCAGGAGCTAAGTTACGTAAT
GCTTCGGGAGAAATCACTACAATCAAAAAAGCTAAAATTCGTGGGCTCGA
ATCACAAGGAATGTGTTGTGGAGCAGACGAATTAGGGTTCCCTCATTTAC
AAAAAGCAGAGCGTGGTATTTTTGAGTTCCCTGCAGATACTCCTCTTGGA
GAAAGTGCCTGCATGCTACTTGCTGGAGCTCCCCTAGAATGCTCGTTAAC
CCCTAATTTAGGCCATTGCGCATCCTTACTAGGCCTAGCAAGAGAAATTT
CCTTTCTATCCCCTGTATCTCTTAATATCCCGGAAGAATTTTCTTTTGCC
TCGCTTCCTCAAGAAACTTCTATTTGTGATATGCACGATGCTGGAGCTTG
CCCCGTATTCTATTCCGTCAAAATCTCGGGTCTATCTTGTCGACGATCCC
CAGAATATCTGCAAGCAGCCTTAACAGCTCTTGGACAAAAACCTCTTAAC
GCCATCGTTGATATTACGAATTATGTGATGCTGTCATTAGGTCAGCCCCT
ACATGCTTACGATAGCCAAGCGGTGGAGCAAAAGTCTCTCCATGCAGCCA
CTCTACAGTCAGCTCAACCACTTACTCTTCTAAATCAAGAAACCTATACC
CTCCCCGCAGGATCTTTAGTCGTTGCTGATCAGCATAATATCTTAGGATT
AGCTGGGGTCATGGGAAGTGCTGCATCTTCTTGCTCAGAAAATACAACAG
AAATCATTCTGGAAGCCGCTTACTTCCAGCCTCAGGCTGTAAGAAAATAT
CAACGCACGATACAGCTGCACACAGAAGCTGCCTATAGATTTACCCGAGG
AGTGGATCCTCAAGGCGTATTACCCGTGTTACATGCTGCTATCCATATGA
TTCAATCTCTATTTCCGGATGCTCAAATCTCTCCTATTCAAAAAATTGGA
GATGATAGCTTTTCTCCTTTGTCTTTAAGCGTTCGCCCTAAAACGATTAA
AAGACTTCTGGATATTGAGCTCTCGACCGCAGAAATAGTTGCCAAACTCT
CTTCTTTAGGATTTCAAACAGCAGTAGAAGAGCAGGCCGTTCGAGTCGAG
GTCCCCTCTTACCGTCATGACATTCAGGAAGAGACCGACCTTGTTGAAGA
GATCTGTCGCACCACACCATTCGTTCAAAAAACACAAAAAATACTCCCGA
CCTATACTCCGATCTATTCTTTGAAACGTGAACTCACAGCTTTCTTAGCA
AATGGTGGGCTACAACAATTCTTTACCTACTCCTTGCTGGATACAGAAGT
ATCTTCCTTATCTTTGCAAGAAAGCTCTTTGATTCCTGTACAGAATTCTT
CCTGGAAATTACGCGACTCCCTTCTTCCTGGGATGCTAAAAAGTGCGGCT
ACTAACCTCCATAGGCAAGCCCCCTATGTTTATGCTTTTGAAATTGGAAA
TGTGTACTCGAAGGAGCAGAACCGTTACCAAGAGGAAGAGCGTGTTGCTA
TTTTACTCTCTCGCCAAGTAATGGATGATTCCTGGCAAGGGAAAACACCT
CTCTCTTTTTATACAATCAAAGGATGGGTGGAAAAACTATTATGCCAGTC
AGGAGCTTCTATAGAAGACTTTTCTCTTCAACCCAGCCAGCATCCGAACT
TTCACCCTTATCAGCAAGCTGCCTTGTATCAGAAAAAACATCTATTAGGC
ATCTTTGGGACGTTGCACCCACAACTATGTAGAAAAGCTCAGATCAAACA
CGATGTAGTCTTTGCTGAGCTTTCTTTAAATGTGCTTTTGTCTTTAAAAA
AGAAATCCGGACCTCATTACGTACCCTATCCAATCTATCCGGCCTCTTCC
AGAGACATTACAATTACAATAGATAGAGATCTTCCAGCAGATCTCGTACG
CAGAGAACTTTTAAGTTTCGAATCTAAATGGCTTGAAAGTGTTCATATTG
TCAGTGTATATCAAGGGAGAGACTCTGCATCTCAAAGTAAAAACGTTTCT
CTTCGGATGGTCTTCCGTGATCACGAACGAACCTTATCCGGGCAGGAAAT
AGAAGAAGAATACGAACGTTTAACTGCATTACTTGATAAGAAATTAGCCA
ACATAGGACAAGGCAACTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy