Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR375 IGR376 IGR377 IGR379 IGR380 IGR378 CT458 CT457 murA, - CT455 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 CT458 CT457 murA, - CT455 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 Type: tandem, Name:  - 2 CT457 murA, - CT455 CT458 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456
* Calculated from Protein Sequence

Gene ID: CT455

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murA  

Definition:
UDP-N-acetylglucosamine-1-carboxyvinyltransferase

Gene Start:
530696

Gene Stop:
529365

Gene Length:
1332

Molecular Weight*:
48396

pI*:
6.61

Net Charge*:
-3.50

EC:
2.5.1.7  

Functional Class:
cell envelope; peptidoglycan  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:
In E.coli, the MurA protein catalyzes the reaction between PEP and UDP-N-acetyl-D-glucosamine to form orthophosphate and UDP-N-acetyl-3-(1-carboxyvinyl)-D-glucosamine, as part of the peptidoglycan biosynthetic pathway. The enzyme is attacked by the drug phosphomycin.
An X-ray crystallographic structure is available for this protein.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to UDP-N-acetylglucosamine 1-carboxyvinyltransferase sequences, e.g. residues 1-434 are 33% similar to MURA_ECOLI. CT455 is similar to TP0029 in T.pallidum. No similarity to M.genitalium.

CT455 is orthologously related to CPn0571: residues 5-434 of CT455 are 70% similar to residues 5-434 of CPn0571, a predicted UDP-N-acetylglucosamine-1-carboxyvinyltransferase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0766
COG name: UDP-N-acetylglucosamine enolpyruvyl transferase
Functional Class:  M
The phylogenetic pattern of COG0766 is -----qvceBrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Low complexity in residues 192-206 appears to be responsible for a match to block PR00631A (monellin B chain signature as seen in MONB_DIOCU).

ProDom Summary:  Protein Domain Search
Residues 5-190 are 38% similar to a MurA domain as observed in MURA_HAEIN. Residues 192-274, 244-258, 296-405 are consistent with this assignment as evidenced by similarities to MURA_HAEIN and MURA_BACSU. Residues 20-141 are 27% similar to a AroA domain as observed in AROA_LACLA.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 8 to 427 (E-value = 3.7e-156) place CT455 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

PDB Hit:
gi|2392464|pdb|1NAW|A chain A, enolpyruvyl transferase peptidoglycan biosynthesis, hinge, domain movement, sequence motif, folding, transferase mol_id: 1; molecule: udp-n-acetylglucosamine 1-carboxyvinyl-transferase; chain: A, B; ec: 2.5.1.7; engineered

Gene Protein Sequence:
MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKNVPNIEDV
RQTVDLCRVLGAIVEWDQQAQVIEIHTPRILLSKVPPQFSCVNRIPILLL
GALLRRCPYGIFVPILGGDAIGPRTLHFHLEGLKKLGAEIVISDEGYWAS
APNGLVGAHITLPYPSVGATENLILASVGAQGRTIIKNAALEVEIIDLIV
FLQKAGVEITTDNDKTIEIFGCQDFYSVEHSIIPDKIEAASFGMAAVVSQ
GRIFVEQARHEHMIPFLKVLRSIGGGFSVHENGIEFFYDKPLKGGVLLET
DVHPGFITDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCD
LFHECLSAKSCRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAA
LIAEGGASWIENTEMLDRGYTDWRGKLERLGAKVLARDSVSVYV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGGTATCAAGGTTTTTGGAGAAACGGTCTTAAGAGGGTCTGTGCG
CGTGTCAGGAGCTAAAAATGCTACAACTAAATTACTTGTAGCCTCCTTAC
TTTCGGATCAGCGAACGATTTTAAAGAACGTCCCTAATATTGAAGATGTT
CGGCAAACGGTAGATCTTTGTCGGGTTTTAGGGGCGATTGTAGAGTGGGA
TCAGCAAGCGCAAGTGATTGAAATTCACACTCCGCGCATTTTATTGTCCA
AGGTTCCTCCGCAATTTTCTTGTGTTAATCGGATTCCTATTTTGCTGTTA
GGAGCGTTGTTACGTCGTTGTCCTTATGGGATTTTTGTTCCTATTTTGGG
AGGGGATGCTATAGGACCTCGTACGCTACATTTCCATTTAGAAGGATTGA
AGAAGCTTGGAGCAGAGATAGTAATTAGTGATGAAGGCTATTGGGCTTCA
GCTCCAAATGGTCTTGTTGGAGCACACATCACGTTACCCTACCCTTCTGT
GGGAGCCACAGAAAACCTCATCCTTGCTTCTGTAGGGGCTCAAGGACGAA
CGATTATTAAGAATGCTGCTCTTGAAGTGGAAATCATTGATTTGATTGTC
TTTTTACAGAAAGCTGGCGTGGAGATTACAACAGATAATGATAAGACCAT
CGAAATTTTTGGATGTCAGGATTTCTATTCTGTTGAGCACTCCATTATTC
CAGATAAAATCGAGGCTGCTTCTTTCGGTATGGCTGCGGTAGTTTCTCAG
GGGAGGATCTTCGTAGAACAAGCGCGCCATGAGCATATGATCCCTTTTTT
AAAGGTATTAAGATCGATAGGAGGGGGATTCTCTGTACACGAGAATGGGA
TCGAATTTTTCTACGATAAGCCTTTGAAAGGGGGAGTTCTTCTAGAAACG
GATGTGCATCCAGGGTTTATTACAGATTGGCAACAACCTTTTGCCGTATT
GCTCTCTCAGTCAGAAGGTTGTTCGGTGATCCATGAGACAGTGCATGAGA
ATCGTCTTGGGTATTTGAAAGGTTTGGTAAAAATGGGAGCGCATTGTGAT
TTATTTCACGAGTGTTTGAGTGCTAAGTCGTGTCGCTATTCTACAGGGAA
TCATCCTCATAGCGCAGTCATTCATGGTCCGACTCCTTTGCAGGCAACAG
ACTTAGTGATTCCTGATTTGCGCGCAGGATTTGCTTATGTCATGGCCGCA
CTCATTGCAGAAGGCGGAGCCTCATGGATTGAGAATACCGAGATGCTGGA
TCGAGGGTACACTGATTGGCGAGGGAAATTAGAAAGATTAGGAGCTAAGG
TTTTAGCGCGAGACTCAGTATCTGTGTATGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy