Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR375 IGR376 IGR377 IGR378 IGR373 IGR374 CT449 murA, - CT455 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 CT449 murA, - CT455 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 Type: tandem, Name:  - 2 CT449 murA, - CT455 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456
* Calculated from Protein Sequence

Gene ID: CT454

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argS  

Definition:
arginyl-tRNA synthetase

Gene Start:
527633

Gene Stop:
529321

Gene Length:
1689

Molecular Weight*:
62970

pI*:
6.47

Net Charge*:
-6.89

EC:
6.1.1.19  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
The E.coli enzyme is believed to be a monomer that belongs to the Class I aminoacyl-tRNA synthetases.
Reaction: ATP + l-arginine + tRNA(arg) = AMP + pyrophosphate + l-arginyl-tRNA(arg).


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to arginyl-tRNA synthetase sequences,
e.g. residues 30-563 are 39% similar to SYR_ECOLI. CT454
is similar to TP0831 and MG378 in M.genitalium, both arg-tRNA
synthetases.

CT454 is orthologously related to CPn0570: residues 1-563 of CT454
are 71% similar to residues 1-561 of CPn0570, a predicted arginyl-tRNA
synthetase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0018
COG name: Arginyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0018 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Although the percentile score is relatively weak (93%),
residues 30-40 and 123-133 match block BL00178A, which comprises
aminoacyl-tRNA synthetase sequences, e.g., SYR_CAEEL.

ProDom Summary:  Protein Domain Search
Residues 117-528 are 47% similar to an arg-tRNA synthetase domain as
observed in SYR_SYNY3. Residues 30-96 support this assignment
as evidenced by the similarity to SYR_CRILO.

Paralogs:  Local Blast Search
No evidence paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 88 (E-value = 3.4e-32) place CT454 in the Arg_tRNA_synt_N family which is described as Arginyl tRNA synthetase N terminal domain (PF03485)
Residues 96 to 436 (E-value = 8.4e-110) place CT454 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 450 to 563 (E-value = 2.5e-37) place CT454 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
14
coil-coil  
171  
198
non-globular  
466  
516

PDB Hit:
none

Gene Protein Sequence:
MTTLLSFLTSLCSAAIHQAFPELEELTLDITPSTKEHFGHYQCNDAMKLA
RVLHKSPRAIAESIVAHIPPTPFSSIEIAGAGFINFTFSKEFLASQLQTF
SKELANGFRAASPQKVIIDFSSPNIAKDMHVGHLRSTIIGDCLARCFSFV
GHDVLRLNHIGDWGTAFGMLITYLQETSQEAIHQLEDLTALYKKAHARFA
EDSEFKKRSQHNVVALQSGDAQALALWKQICSVSEKSFQTIYSILDVELH
TRGESFYNPFLAEVVADLESKNLVTLSDGAKCVFHEAFSIPLMIQKSDGG
YNYATTDVAAMRYRIQQDQADRILIVTDSGQSLHFQLLEATCLAAGYLPS
KGIFSHVGFGLVLDTQGRKFKTRSGENIKLRELLDTAVEKAKESLKAHRP
DISEEELAYQGPILGINAIKYADLSSHRINDYVFSFEKMLRFEGNTAMSL
LYAYVRIQGIKRRMGLESPPQEGPLAVHEPAEEALALTLLRFPEILDLTL
RELCPHFLTDYLYALTNKFNAFFRDCHIEGSDSQQERLYLCGLTERTLST
GMHLLGLKTLNHL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACACTTCTTTCTTTTCTGACTTCGCTATGTTCTGCAGCGATTCA
TCAAGCCTTCCCTGAGTTGGAAGAGCTAACCTTAGACATCACTCCCTCTA
CTAAGGAGCATTTTGGACATTATCAATGTAACGATGCAATGAAACTTGCA
CGTGTATTACACAAATCCCCTCGTGCCATTGCCGAATCGATCGTTGCGCA
TATTCCTCCCACTCCTTTTTCCTCTATAGAGATTGCAGGAGCTGGATTTA
TCAATTTTACTTTCTCAAAAGAATTCCTAGCTAGTCAGCTCCAAACCTTC
TCAAAAGAATTAGCAAATGGGTTTCGTGCTGCGTCTCCTCAAAAAGTTAT
TATTGATTTTTCTTCTCCTAATATTGCTAAAGATATGCATGTAGGCCATC
TGCGCTCCACGATTATCGGAGATTGTTTAGCACGATGCTTTTCCTTTGTC
GGCCATGACGTCTTACGCTTAAACCATATTGGAGATTGGGGTACAGCTTT
TGGTATGCTAATCACCTATCTGCAAGAGACCTCTCAGGAGGCGATTCATC
AACTAGAAGATCTCACTGCATTATATAAAAAGGCTCACGCGCGTTTCGCA
GAAGACTCTGAATTTAAAAAACGCTCCCAACATAACGTTGTAGCCTTACA
ATCCGGAGATGCTCAAGCTCTTGCACTATGGAAACAAATCTGTTCCGTTT
CTGAGAAATCCTTTCAGACAATCTACTCGATTTTGGATGTTGAGCTCCAT
ACACGCGGCGAATCATTTTATAATCCTTTCCTAGCAGAGGTTGTCGCAGA
CTTAGAATCTAAAAACCTTGTCACGCTTTCTGATGGCGCAAAATGCGTAT
TCCATGAAGCCTTCTCTATTCCTCTCATGATTCAAAAGAGTGATGGCGGA
TACAATTACGCAACAACCGATGTCGCAGCTATGCGCTATCGCATCCAACA
AGATCAGGCCGATAGAATTCTTATCGTTACAGACTCAGGACAATCCTTAC
ACTTCCAGCTTCTAGAAGCAACGTGCTTAGCAGCAGGCTATCTTCCTTCT
AAAGGGATCTTTTCACATGTAGGATTTGGACTTGTCTTGGATACTCAAGG
AAGAAAATTCAAAACACGTTCGGGAGAGAACATCAAATTACGAGAACTTC
TCGATACAGCAGTGGAAAAAGCGAAAGAGTCTCTAAAAGCACATCGTCCA
GACATCTCAGAAGAAGAACTGGCATATCAAGGCCCTATCCTTGGTATTAA
TGCAATTAAATATGCAGACCTTTCTTCTCATAGAATCAATGACTACGTGT
TCTCTTTCGAGAAGATGCTCCGCTTCGAAGGAAATACAGCGATGTCTCTC
CTGTATGCCTATGTACGTATCCAAGGAATTAAACGCAGAATGGGATTAGA
ATCTCCGCCTCAAGAAGGGCCTCTTGCTGTTCATGAGCCTGCAGAAGAAG
CGTTAGCACTTACTCTTTTACGTTTCCCTGAAATTTTGGACCTCACCCTC
AGAGAACTCTGTCCTCATTTCCTAACTGACTATCTCTATGCACTCACCAA
TAAGTTCAATGCTTTCTTCCGCGATTGCCATATCGAAGGATCCGATTCTC
AGCAAGAACGTCTTTATCTCTGCGGACTTACCGAACGAACGCTATCAACA
GGTATGCACTTACTAGGTCTTAAAACCTTGAATCACCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy