Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR375 IGR376 IGR377 IGR378 IGR373 IGR374 CT449 murA, - CT455 secD,secF, - CT448 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 CT449 murA, - CT455 secD,secF, - CT448 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 Type: tandem, Name:  - 2 CT449 murA, - CT455 secD,secF, - CT448 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456
* Calculated from Protein Sequence

Gene ID: CT453

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
plsC  

Definition:
1-acyl-sn-glycerol-3-phosphate acyltransferase

Gene Start:
526968

Gene Stop:
527615

Gene Length:
648

Molecular Weight*:
23810

pI*:
10.86

Net Charge*:
14.85

EC:
2.3.1.51  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:
The PLSC protein, in E.coli and M. genitalium, is involved in phospholipid biosynthesis, converting acyl-CoA and 1-acyl-SN-glycerol 3-phosphate to CoA + 1,2-diacyl-SN-glycerol 3-phosphate. See CT775 for another possible sequence.
See CT451, CT452, CT454, and CT455 for possible connectedness. See CT807.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical proteins and to 1-acylglycerol-
3-phosphate O-acyltransferase sequences, e.g., residues
10-207 are 33% similar to a putative acylglycerophosphoethanolamine
acyltransferase sequence from A.aeolicus (AE000770). Residues
12-203 are 29% similar to a hypothetical protein from
M.tuberculosis (ALO21957). CT453 is weakly similar to MG212 in
M.genitalium. No similarity to T.pallidum.

CT453 is orthologous to CPn0569: residues 1-216 are 46% similar to CPn0569.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0204
COG name: 1-acyl-sn-glycerol-3-phosphate acyltransferase
Functional Class:  I
The phylogenetic pattern of COG0204 is ----YQvCEbRhujgpolINX
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 36-194 are 23% similar to a glycerol phosphate acyltransferase
domain as observed in PLSC_MYCGE. Residues 1-146 are also matched to
an acylglycerophosphoethanolamine domain as seen in
AAS_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 22 to 145 (E-value = 6.3e-26) place CT453 in the Acyltransferase family which is described as Acyltransferase (PF01553)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
60
transmembrane  
131  
147

PDB Hit:
none

Gene Protein Sequence:
MIFTIAKSLVRLLFPLFYRRKILRSKASATVKGAAIIAANHVSFLDPIII
PLAFPGKLYQLAKSGLFSNSFTNRLFRELGCYPISRNAGNAAAFKAALNI
FSHGGRLIIYPEGTRHADGEIHQGKVGVGMLAIKGNVPVIPVYVAGTFEA
FGKNQKFPKLWRTLTTVIGSPISFQDLIDNPAIDKKEAYQLATDRIMTKI
TELRTWFQQGCIGEIP

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTTTACTATCGCCAAAAGCCTTGTTCGCTTACTGTTCCCTCTGTT
TTACAGAAGAAAAATCCTGAGGTCGAAAGCAAGCGCTACCGTGAAAGGAG
CCGCTATTATTGCAGCGAATCATGTTTCCTTTCTTGACCCCATCATAATC
CCTTTAGCTTTCCCAGGGAAATTGTATCAGCTAGCTAAGTCCGGACTGTT
TTCTAATTCATTCACTAACAGGCTTTTCCGTGAATTAGGATGCTACCCAA
TTAGCAGAAACGCTGGAAATGCTGCGGCCTTTAAAGCTGCTCTAAATATC
TTTTCCCATGGAGGGAGGCTCATCATTTACCCCGAAGGAACCCGTCATGC
CGACGGAGAAATTCATCAAGGCAAAGTAGGCGTGGGTATGCTGGCTATCA
AAGGCAATGTCCCTGTTATTCCCGTTTACGTGGCAGGAACTTTCGAAGCC
TTCGGCAAGAACCAAAAATTTCCTAAGCTTTGGAGAACTTTGACTACTGT
AATAGGCTCGCCTATTTCATTCCAAGACCTCATAGATAACCCTGCTATTG
ATAAAAAAGAGGCTTACCAATTAGCAACTGACCGCATTATGACCAAGATC
ACCGAACTTCGTACTTGGTTCCAACAAGGATGCATTGGAGAAATCCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy