Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR375 IGR376 IGR377 IGR378 IGR373 IGR374 CT449 murA, - CT455 secD,secF, - CT448 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 CT449 murA, - CT455 secD,secF, - CT448 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456 Type: tandem, Name:  - 2 CT449 murA, - CT455 secD,secF, - CT448 plsC, - CT453 cmk, - CT452 yaeS, - CT450 cdsA, - CT451 argS, - CT454 CT456
* Calculated from Protein Sequence

Gene ID: CT452

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cmk  

Definition:
cytidylate kinase

Gene Start:
526321

Gene Stop:
526968

Gene Length:
648

Molecular Weight*:
24007

pI*:
4.99

Net Charge*:
-4.66

EC:
2.7.4.14  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidines  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
This enzyme converts CMP to CDP. The sequence similarity to ORF00327 of T.pallidum is curious. Could this gene be connected to CT451, CT453, CT454, and CT455.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to cytidylate kinase sequences
e.g. residues 3-211 are 35% similar to KCY_BACSU.
Residues 7-36 are 36% similar to a stretch of adenylate
kinase sequence from trachomatis (U39695). CT452 is similar to
TP0279, a predicted ribosomal S1 protein in T.pallidum: residues
1-207 are 29% similar to this protein. It is similar to MG330, a
predicted cytidylate kinase in M.genitalium.

CT452 is orthologously related to CPn0568: residues 1-211
are 68% similar to CPn0568.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0283
COG name: Cytidylate kinase
Functional Class:  F
The phylogenetic pattern of COG0283 is -----qvcebrH--gpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 2-17 match a disease resistance protein block, PR00364A,
perhaps because of shared glycine residues.

ProDom Summary:  Protein Domain Search
Residues 3-190 are 40% similar to a cytidylate kinase domain
as observed in KCY_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 53 to 209 (E-value = 4.4e-87) place CT452 in the Cytidylate_kin family which is described as Cytidylate kinase (PF02224)

PDB Hit:
none

Gene Protein Sequence:
MIITIDGPSGTGKSTLAKALAQTLQFLYCNTGAMYRTLAYARLQPDWQEV
PLEDFLASPPFSFSFSKDSPLQAFYGDRLLTSELSSQEVANFASLFSKEP
LVRAYMQTLQKQYATVGNCVFEGRDMGSKVFPHAEVKIFLTAKPEIRAER
RLKDLPQGSLSKEALMAELIARDQADQQRECDPLVIPQDATVIDSSDLTI
SQILEKILPLIPSHLT

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCATCACTATAGATGGGCCGTCAGGAACAGGAAAAAGTACGCTAGC
AAAAGCTTTGGCTCAAACGCTGCAGTTTCTTTACTGCAACACAGGTGCCA
TGTATCGAACGCTTGCCTACGCTCGCCTCCAGCCTGATTGGCAAGAAGTC
CCATTAGAAGATTTTCTTGCTTCACCTCCTTTTTCTTTCTCCTTTTCTAA
AGATTCTCCTTTACAAGCTTTCTATGGAGATCGCCTTCTCACTTCCGAGT
TAAGCTCTCAAGAAGTAGCGAATTTTGCATCGCTCTTCTCTAAGGAGCCT
CTAGTTCGAGCCTACATGCAAACCTTACAAAAGCAATACGCGACAGTAGG
GAATTGTGTATTTGAAGGCCGCGATATGGGCTCGAAAGTGTTCCCCCATG
CTGAAGTAAAAATCTTCTTAACAGCTAAACCAGAGATTCGTGCAGAACGA
CGCCTAAAAGACCTCCCTCAAGGTTCCTTGTCTAAAGAGGCTTTAATGGC
AGAACTCATTGCTCGTGACCAAGCAGATCAACAAAGAGAGTGCGATCCTC
TTGTGATCCCTCAAGATGCCACAGTTATTGACTCTTCTGATTTGACAATA
AGCCAAATTCTGGAGAAAATCCTACCTTTGATACCCTCCCATTTAACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy