Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR372 IGR366 IGR368 IGR367 IGR370 IGR369 IGR371 omp3,omcA, - CT444 CT442 euo, - CT446 gltX,gluS, - CT445 omcB,omp2, - CT443 recJ, - CT447 secD,secF, - CT448 CT444.1 prc,tsp, - CT441 omp3,omcA, - CT444 CT442 euo, - CT446 gltX,gluS, - CT445 omcB,omp2, - CT443 recJ, - CT447 secD,secF, - CT448 CT444.1 prc,tsp, - CT441 omp3,omcA, - CT444 CT442 euo, - CT446 gltX,gluS, - CT445 omcB,omp2, - CT443 recJ, - CT447 secD,secF, - CT448 CT444.1 prc,tsp, - CT441
* Calculated from Protein Sequence

Gene ID: CT445

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gltX  gluS  

Definition:
glutamyl-tRNA synthetase

Gene Start:
516123

Gene Stop:
514606

Gene Length:
1518

Molecular Weight*:
58501

pI*:
6.53

Net Charge*:
-2.83

EC:
6.1.1.17  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Primary Evidence:
Wichlan DG, Hatch TP. 1993. Identification of an early-stage gene of Chlamydia psittaci 6BC. J Bacteriol 175(10):2936-42. Medline: 8491714.

Comment:
This protein, a monomer in B.subtilis, belongs to Class I aminoacyl-tRNA synthetases.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glutamate tRNA ligase sequences,
e.g., residues 3-472 are 38% similar to SYE_BACSU.
Residues 1-506 are 81% similar to the homologous sequence
in C.psittaci (U41759); see also the similarity to L13598. CT445
is similar to TP0673 in T.pallidum and MG462 in M.genitalium, both
glu-tRNA synthetases.

CT445 is orthologously related to CPn0560: residues 1-503 of CT445
are 79% similar to residues 1-503 of CPn0560, a predicted glutamyl-tRNA
synthetase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
The similarity to SYE_CHLPS dominates the output: residues
9-165, 170-257, 194-331, 258-328, 344-487 are the recognized
glu-tRNA synthetase domains.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 5 to 322 (E-value = 3.6e-155) place CT445 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

PDB Hit:
gi|1311358|pdb|1GLN| Mol_id: 1; Molecule: Glutamyl-Trna Synthetase; Chain: Null

Gene Protein Sequence:
MTVQNVRVRVAPSPTGDPHVGTAYMALFNEVFARKYNGQMILRIEDTDQT
RSRDDYEANIFSALKWCGIRWDEGPDVGGAYGPYRQSERTEIYKKYAEIL
LQTDCAYKCFATPQELQEMRAVASTLGYRGGYDRRYRYLSPEEVRQREEQ
GQPYTIRLKVPLTGESVFEDQCKGCVVFPWADVDDQVLVKSDGFPTYHFA
NVVDDHLMGITHVLRGEEWLSSTPKHLLLYEAFGWEPPQFFHMPLLLNPD
GSKLSKRKNPTSIFYYRDAGYKKEAFMNFLTLMGYSMEGDEEIYSMQRLI
EAFDPKRIGRSGAVFDIRKLDWMNKHYLNHEGSPESLLQELKGWLWNDEF
LLKILPLCQSRITTLADFVGLTSFFFTAIPQYSKEELLPSSLKQEQAAVM
LYSLVKYLEKKDLWEKDFFYQGSKWLAEAFQVHHKKAVIPLLYVAITGAK
QGLPLFDSMELLGKARTRARLTYAQNLLGGVSKKVQQQVDKALQDQPLED
IRFLDF

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGTCCAAAATGTACGCGTTAGAGTAGCCCCTTCTCCTACAGGAGA
TCCTCATGTGGGGACTGCTTATATGGCTCTGTTTAATGAGGTTTTTGCAA
GAAAATATAATGGGCAAATGATTTTGAGGATTGAAGATACGGATCAAACT
CGAAGTCGGGACGATTATGAAGCAAATATTTTCTCCGCCCTCAAGTGGTG
CGGAATTCGTTGGGACGAAGGTCCAGATGTTGGAGGAGCTTATGGCCCTT
ATCGGCAGTCCGAACGCACAGAGATTTACAAAAAATACGCAGAGATCCTC
TTACAAACAGATTGTGCGTACAAGTGTTTTGCTACTCCTCAAGAATTGCA
GGAAATGCGGGCGGTTGCCAGTACTCTGGGGTACAGAGGAGGATACGATC
GCCGGTATCGTTACCTATCTCCAGAGGAAGTTCGACAAAGAGAAGAGCAA
GGACAGCCTTATACCATTCGTTTGAAAGTGCCTTTGACGGGAGAAAGTGT
TTTTGAAGATCAATGCAAAGGTTGTGTCGTTTTCCCTTGGGCAGATGTTG
ACGATCAAGTTTTGGTTAAATCAGACGGGTTCCCTACGTATCACTTTGCT
AATGTAGTTGATGATCATTTGATGGGGATTACCCATGTGTTGCGAGGGGA
AGAGTGGTTAAGTTCTACACCTAAACACCTTCTTCTTTACGAAGCTTTTG
GGTGGGAGCCTCCGCAGTTTTTCCATATGCCGCTTCTTCTAAATCCTGAT
GGAAGTAAGCTTTCCAAGAGAAAGAATCCTACTTCTATTTTTTACTATCG
GGATGCTGGATACAAAAAAGAAGCGTTCATGAATTTCCTGACCCTAATGG
GGTATAGTATGGAAGGGGATGAAGAGATTTATTCCATGCAGCGTTTGATA
GAAGCGTTTGATCCTAAACGAATTGGAAGATCCGGAGCCGTTTTCGATAT
CCGTAAGTTAGACTGGATGAACAAACACTATCTTAACCACGAAGGATCTC
CAGAGAGTCTCTTACAAGAATTGAAGGGGTGGCTCTGGAATGACGAGTTT
TTATTGAAAATTCTTCCTCTCTGTCAATCACGTATCACTACGTTAGCCGA
TTTCGTTGGGTTAACCAGCTTCTTTTTCACTGCGATTCCTCAATATAGTA
AAGAGGAGTTATTGCCATCTTCGCTTAAGCAAGAGCAGGCTGCAGTCATG
TTGTATAGCCTAGTGAAGTATTTAGAGAAGAAGGATCTATGGGAGAAAGA
TTTCTTCTATCAAGGATCTAAATGGTTAGCAGAGGCTTTTCAAGTGCATC
ATAAGAAGGCTGTAATCCCTCTGCTATATGTGGCTATTACTGGTGCAAAA
CAGGGACTTCCTCTTTTTGATTCGATGGAATTACTAGGTAAGGCTAGGAC
GCGAGCACGGCTGACCTATGCTCAAAATCTATTGGGAGGAGTATCCAAGA
AAGTGCAGCAGCAAGTCGACAAAGCGTTGCAGGATCAGCCTCTTGAAGAC
ATTAGATTTTTAGACTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy