Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR359 IGR361 IGR356 IGR360 IGR362 IGR363 IGR358 IGR365 IGR364 IGR357 rs10, - CT436 rs12, - CT439 rs7, - CT438 dapF, - CT430 cysJ, - CT435 glyA, - CT432 fusA, - CT437 CT440 CT434 CT433 prc,tsp, - CT441 rs10, - CT436 rs12, - CT439 rs7, - CT438 dapF, - CT430 cysJ, - CT435 glyA, - CT432 fusA, - CT437 CT440 CT434 CT433 prc,tsp, - CT441 rs10, - CT436 rs12, - CT439 rs7, - CT438 dapF, - CT430 cysJ, - CT435 glyA, - CT432 fusA, - CT437 clpP, - CT431 clpP, - CT431 CT440 CT434 CT433 prc,tsp, - CT441
* Calculated from Protein Sequence

Gene ID: CT435

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cysJ  

Definition:
probable sulfite reductase

Gene Start:
505166

Gene Stop:
504117

Gene Length:
1050

Molecular Weight*:
39869

pI*:
7.62

Net Charge*:
2.32

EC:
1.8.1.2  

Functional Class:
amino acid biosynthesis; selenocysteine  
central intermediary metabolism; sulfur metabolism  

Pathway: pathway table
Selenoamino acid metabolism
Sulfur metabolism

Comment:
In E.coli the sulfite reductase (CYSJ) catalyzes the reduction of sulfite to sulfide in an NADP-dependent reaction. The alpha subunit is a flavoprotein and the beta subunit is a hemoprotein. It is not clear that subunits exist in C.trachomatis. Blasting the E.coli alpha and beta subunits against ctpro_all, CT435 is clearly the only responder. (Unfortunately what is given to be the E.coli beta subunit is identical to the E.coli alpha subunit.)

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to sulfite reductase sequences and ferrihemoprotein reductase
sequences, e.g., residues 27-350 are 27% similar to the sulfite reductase from E.coli (U29579).
Residues 17-350 are 27% similar to the ferrihemoprotein reductase from Helianthus tuberosus
(Z26250). No similarities to T.pallidum or M.genitalium.
CT435 is orthologously related to CPn0548: residues 1-350 are 50% similar to CPn0548.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0369
COG name: Sulfite reductase flavoprotein subunit
Functional Class:  P
The phylogenetic pattern of COG0369 is ----Y--ceB--------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 48-58, 148-155, 181-190, 219-238, 244-253, 257-268, 287-303,
310-318 are significantly matched to blocks PR00371A,B,C,D,E,F,G,H, which
comprise cytochrome reductase signatures, e.g., NOS1_HUMAN, FENR_PEA,
HTU2NFR, among others. Residues 148-155 and 219-238 are matched to blocks
PR00410B,D, which include phenol hydroxylase reductase family signatures,
e.g., RFBI_SALTY, BENC_ACICA.

ProDom Summary:  Protein Domain Search
Residues 149-315 are 36% similar to a reductase domain as observed in
NCPR_MUSDO.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis, however weak similarities are
observed to CT742, thought to be an RNA methylase: residues 254-341 are
26% similar to this protein (E value of 0.004).

Pfam Summary:  Pfam Search
Residues 5 to 186 (E-value = 1.9e-07) place CT435 in the FAD_binding_1 family which is described as FAD binding domain (PF00667)
Residues 215 to 326 (E-value = 2.3e-14) place CT435 in the NAD_binding_1 family which is described as Oxidoreductase NAD-binding domain (PF00175)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
290  
329

PDB Hit:
gi|3318958|pdb|1AMO|A Chain A, Three-Dimensional Structure Of Nadph-Cytochrome P450 Reductase: Prototype For Fmn- And Fad-Containing Enzymes X-Ray Crystallography, Flavoprotein, Nitric Oxide Synthase, Oxidoreductase Mol_id: 1; Molecule: Nadph-Cytochrome P

Gene Protein Sequence:
MSLFSKFKAQWMFLHSRELCSSTSDIGNTCSDPVFQVLCNPVRSEISYKV
GDSLGVFPTNPSILVDSVLDALQYGPRSPVVSRHADSVLPLHEFLTSYVD
LDKIPKSLRPFFPGDLDDTWSLAEAILVYQPRIPFEEFIRSAMPLLPRFY
SIASSPTCSHGKLELLVRCVSFQGKTQLRYGLCSAFLCKDLQEGESFRGF
IQPTRHFTLEQKNFGKPLIMIGAGTGIAPYKGFLQHRIYHQDVGSNILFF
GERFEKSNFYYRDFLQELIVSGKLQLFTAFSRDSESKLYVQNVIEQQKEL
IQEVYEQEAFFFVCGKKILGTEVKRALEQILGPKAVRELIAQKRLVSDVY


Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTATTTTCTAAATTCAAAGCTCAGTGGATGTTTTTACATTCACG
TGAGCTTTGTTCTTCCACATCGGATATTGGGAATACTTGTTCGGATCCTG
TTTTTCAGGTTTTATGTAATCCGGTTCGTTCTGAGATTTCCTATAAAGTT
GGGGATTCTTTGGGGGTATTCCCAACAAATCCTTCCATATTAGTCGATTC
AGTTCTAGATGCTTTACAGTATGGCCCCAGGTCTCCTGTCGTATCTCGGC
ATGCAGATTCTGTTCTCCCTCTTCACGAATTTCTTACTAGTTACGTAGAC
TTAGATAAAATTCCAAAATCGTTAAGACCTTTTTTCCCAGGGGATTTAGA
CGATACCTGGTCTTTAGCTGAAGCTATTTTGGTTTACCAGCCGCGTATTC
CTTTTGAAGAGTTTATTCGGAGTGCGATGCCTTTATTGCCTCGATTTTAT
TCTATAGCTTCTTCTCCAACATGTTCTCATGGGAAGCTAGAGTTGCTCGT
GCGCTGTGTTAGTTTCCAAGGTAAAACGCAGCTGCGCTATGGATTATGTT
CGGCTTTTTTATGTAAGGACTTACAAGAGGGAGAGTCTTTTCGTGGGTTT
ATACAACCGACGCGGCATTTTACTTTGGAGCAGAAAAATTTTGGGAAACC
TTTAATTATGATCGGAGCAGGGACAGGTATCGCTCCGTACAAAGGGTTCT
TACAACATCGAATATACCATCAGGACGTAGGCTCCAATATTCTATTCTTT
GGAGAGCGTTTTGAGAAAAGTAACTTCTATTACCGGGATTTTCTCCAGGA
GCTGATCGTTTCAGGAAAACTCCAGTTATTCACAGCCTTTTCCAGAGATT
CCGAGTCTAAATTGTATGTTCAGAATGTTATAGAGCAACAAAAAGAACTT
ATACAAGAAGTCTACGAACAAGAAGCTTTCTTTTTTGTTTGTGGGAAAAA
AATCCTTGGTACGGAAGTTAAACGTGCTTTAGAGCAGATATTAGGTCCTA
AGGCGGTACGAGAGCTGATTGCACAGAAGAGACTAGTTTCAGACGTATAC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy