Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR359 IGR361 IGR356 IGR360 IGR354 IGR355 IGR358 IGR353 IGR357 rs10, - CT436 dapF, - CT430 CT429 cysJ, - CT435 glyA, - CT432 fusA, - CT437 CT434 CT433 ubiE, - CT428 CT426 CT425 rs10, - CT436 dapF, - CT430 CT429 cysJ, - CT435 glyA, - CT432 fusA, - CT437 CT434 CT433 ubiE, - CT428 CT426 CT425 dapF, - CT430 CT429 cysJ, - CT435 glyA, - CT432 fusA, - CT437 clpP, - CT431 clpP, - CT431 rs10, - CT436 CT434 CT433 ubiE, - CT428 CT426 CT425 CT427 CT427
* Calculated from Protein Sequence

Gene ID: CT431

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
clpP  

Definition:
ATP-dependent ClpP endopeptidase

Gene Start:
500938

Gene Stop:
500363

Gene Length:
576

Molecular Weight*:
21148

pI*:
5.37

Net Charge*:
-4.08

EC:
3.4.21.92  

Functional Class:
translation; proteases  

Pathway: pathway table

Comment:
For reviews, see, "THE CLP ATPASES DEFINE A NOVEL CLASS OF MOLECULAR
CHAPERONES." 1996. WAWRZYNOW A, BANECKI B, ZYLICZ M. MOLECULAR
MICROBIOLOGY 21(5): 895-899 and "New insights into the ATP-dependent
Clp protease: Escherichia coli and beyond." 1999. Porankiewicz J,
Wang JM, Clarke AK. MOLECULAR MICROBIOLOGY 32(3): 449-458.


CT431 got shorter 100%I
In E.coli, this enzyme cleaves peptides internally in a process that uses
ATP. It is a dimeric protein that requires a regulatory subunit (clpA
or clpX) as well as this proteolytic subunit. For the regulatory
subunits, see CT286, CT113, CT705, and CT706. See CT706 for another ClpP sequence.

From Prosite PDOC00358:

The endopeptidase Clp (EC 3.4.21.92) from Escherichia coli cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp is a dimeric protein which consists of a proteolytic subunit (gene clpP) and either of two related ATP-binding regulatory subunits (genes clpA and clpX). ClpP is a serine protease which has a chymotrypsin-like activity. Its catalytic activity seems to be provided by a charge relay system similar to that of the trypsin family of serine proteases, but which evolved by independent convergent evolution.

Proteases highly similar to ClpP have been found to be encoded in the genome of the chloroplast of plants and seem to be also present in other eukaryotes.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ATP-dependent Clp protease endopeptidase subunits,
e.g., residues 17-186 are 46% similar to CLP3_SYNY3. Residues 17-186 are 40% similar to TP0507 of T.pallidum, a predicted CLP protease.
See also T.p. TP1041. No similarity to M.genitalium.

CT431 is orthologously related to CPn0520: residues 1-192 of CT431
are 84% similar to residues 1-191 of CPn0520, a predicted
ATP-dependent ClpP endopeptidase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0740
COG name: Protease subunits of ATP-dependent proteases, ClpP family
Functional Class:  O
The phylogenetic pattern of COG0740 is -----qvCebRhuj--OLINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 13-49, 68-119, 142-185 are similar to blocks BL00381A-C, which encompass
endopeptidase CLP proteins, e.g. CLP1_SYNP7, CLP3_SYNY3, CLPP_CAEEL.

ProDom Summary:  Protein Domain Search
Residues 12-186 are 44% similar to a CLP protease domain as observed in
CLPP_ECOLI.

Paralogs:  Local Blast Search
CT431 is paralogously related to CT706, a predicted CLP protease:
residues 17-188 are 39% similar to CT706.

Pfam Summary:  Pfam Search
Residues 3 to 189 (E-value = 1.6e-88) place CT431 in the CLP_protease family which is described as Clp protease (PF00574)

PDB Hit:
gi|3318853|pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Peptidase Mol_id: 1; Molecule: Clp Peptidase; Chain: A, B, C, D, E, F, G, H, I, J, K, L, M, N; Synonym: Clpp; Ec: 3.4.21.92; Eng

Gene Protein Sequence:
MPEGEMMHKLQDVIDRKLLDSRRIFFSEPVTEKSATEAIKKLWYLELTNP
GQPIVFVINSPGGSVDAGFAVWDQIKMISSPLTTVVTGLAASMGSVLSLC
AVPGRRFATPHARIMIHQPSIGGTITGQATDLDIHAREILKTKARIIDVY
VEATGQSREVIEKAIDRDMWMSANEAMEFGLLDGILFSFNDL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGAAGGGGAAATGATGCATAAGTTGCAAGATGTCATAGATAGAAA
GTTGTTGGATTCTCGTCGTATTTTCTTCTCCGAACCTGTAACGGAGAAAA
GTGCTACAGAAGCCATCAAAAAGCTTTGGTATTTGGAACTCACCAATCCT
GGGCAGCCAATTGTATTTGTCATTAATAGCCCTGGAGGGTCTGTTGATGC
TGGGTTTGCTGTTTGGGACCAAATTAAAATGATCTCTTCTCCTTTGACTA
CAGTTGTTACAGGTTTAGCAGCATCTATGGGATCTGTATTGAGTTTGTGT
GCTGTTCCAGGAAGACGTTTTGCTACGCCTCATGCGCGCATTATGATTCA
CCAGCCTTCTATTGGAGGAACCATTACTGGTCAAGCCACGGACTTGGATA
TTCATGCTCGTGAAATTTTAAAAACAAAAGCACGCATTATTGATGTGTAT
GTCGAGGCAACTGGACAATCTCGAGAGGTGATAGAGAAAGCTATCGATCG
AGATATGTGGATGAGTGCAAATGAAGCAATGGAGTTTGGACTGTTAGATG
GGATTCTCTTCTCTTTTAACGACTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy