Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR359 IGR356 IGR354 IGR355 IGR358 IGR353 IGR357 dapF, - CT430 CT429 cysJ, - CT435 glyA, - CT432 CT434 CT433 ubiE, - CT428 CT426 CT425 dapF, - CT430 CT429 cysJ, - CT435 glyA, - CT432 CT434 CT433 ubiE, - CT428 CT426 CT425 dapF, - CT430 CT429 cysJ, - CT435 glyA, - CT432 clpP, - CT431 clpP, - CT431 CT434 CT433 ubiE, - CT428 CT426 CT425 CT427 CT427
* Calculated from Protein Sequence

Gene ID: CT430

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapF  

Definition:
diaminopimelate epimerase

Gene Start:
500391

Gene Stop:
499567

Gene Length:
825

Molecular Weight*:
30562

pI*:
4.83

Net Charge*:
-9.45

EC:
5.1.1.7  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis

Comment:
This enzyme is involved in the biosynthetic pathway for lysine.
See CT361, CT362, CT363, and CT364.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to diaminopimelate epimerase sequences, e.g.,
residues 12-262 are 27% similar to DAPF_SYNY3. No similarities to T.pallidum
or M.genitalium.

CT430 is orthologously related to CPn0519: residues 1-256 are 50% similar to CPn0519.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0253
COG name: Diaminopimelate epimerase
Functional Class:  E
The phylogenetic pattern of COG0253 is amt--qvcebrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 15-155 are 30% similar to a diaminopimelate epimerase domain as observed
in DAPF_SYNY3.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 12 to 121 (E-value = 2.2e-05) place CT430 in the DAP_epimerase family which is described as Diaminopimelate epimerase (PF01678)
Residues 139 to 258 (E-value = 1.3e-09) place CT430 in the DAP_epimerase family which is described as Diaminopimelate epimerase (PF01678)

PDB Hit:
none

Gene Protein Sequence:
MGFSSLLTTCRYLLYSGAGNSFILGESMPSLEDVLFLCQEEMVDGFLCVE
SSEIADAKLTVFNSDGSIASMCGNGLRCAMAHVAQCFGLEDVSIETERGV
YQGKFFSMNRVLVDMTLPDWKKAERKLTHVLPGMPEQVFFIDTGVPHVVV
FVSDLSKVPVQEWGSFLRYHEDFAPEGVNVDFVQRKKDDLLLVYTYERGC
ERETLSCGTGMLASALVAADIFSLGQDFSIAVCSRSRNLIKIFSEKGKVF
LEGPVSLLNRSENFGWLEPKSRRFG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGATTCTCTTCTCTTTTAACGACTTGTAGATATCTTTTATATTCTGG
AGCAGGAAACAGTTTCATTTTGGGAGAATCGATGCCTTCTCTTGAGGATG
TTCTGTTTTTATGCCAGGAAGAGATGGTTGATGGGTTTTTATGTGTAGAG
TCTTCTGAAATAGCAGATGCTAAACTCACTGTTTTTAATAGTGATGGATC
TATCGCGTCTATGTGCGGGAATGGGTTGCGGTGCGCAATGGCGCACGTAG
CCCAGTGCTTTGGACTTGAAGATGTTTCTATTGAAACAGAACGTGGTGTT
TACCAAGGTAAGTTCTTTTCTATGAATCGGGTATTGGTTGATATGACATT
ACCTGATTGGAAAAAAGCTGAGCGGAAATTAACGCATGTGTTGCCTGGTA
TGCCGGAACAAGTATTTTTTATTGATACAGGGGTTCCGCATGTCGTGGTT
TTCGTTTCTGATTTAAGTAAGGTTCCCGTACAAGAATGGGGGTCTTTCTT
GCGTTATCATGAAGATTTTGCTCCTGAAGGTGTAAATGTAGATTTTGTTC
AGCGGAAGAAGGATGATCTACTGCTTGTCTATACTTATGAGCGAGGTTGT
GAGCGAGAAACCTTATCTTGTGGGACAGGGATGTTGGCAAGTGCTTTGGT
TGCAGCGGATATCTTTTCTCTAGGACAAGATTTCTCTATAGCGGTGTGTT
CTCGTAGTAGAAATCTGATTAAGATTTTTTCTGAGAAAGGCAAGGTATTT
TTAGAGGGTCCTGTGAGCCTATTGAATCGTAGTGAGAACTTTGGGTGGTT
AGAGCCTAAATCAAGACGTTTTGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy