Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR356 IGR354 IGR355 IGR352 IGR351 IGR353 IGR357 dapF, - CT430 CT429 glyA, - CT432 rsbV, - CT424 CT433 ubiE, - CT428 CT426 tlyC_2, - CT423 CT425 dapF, - CT430 CT429 glyA, - CT432 rsbV, - CT424 CT433 ubiE, - CT428 CT426 tlyC_2, - CT423 CT425 dapF, - CT430 CT429 glyA, - CT432 clpP, - CT431 clpP, - CT431 CT433 ubiE, - CT428 CT426 tlyC_2, - CT423 CT425 CT427 CT427 rsbV, - CT424
* Calculated from Protein Sequence

Gene ID: CT428

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiE  

Definition:
probable ubiquinone/menaquinone methyltransferase

Gene Start:
497799

Gene Stop:
498485

Gene Length:
687

Molecular Weight*:
25828

pI*:
10.20

Net Charge*:
8.11

EC:
2.1.1.-  

Functional Class:
cofactor biosynthesis; ubiquinone and quinones  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:
In B.subtilis, the GRC2 protein methylates (using S-adenosyl-methionine) demethylmenaquinol to form menaquinol. It is also known as spore germination protein C2. See CT219 and CT220.

Blast Summary:  PSI-Blast Search
CT428 is orthologous to CPn0515: residues 6-229 are 51% similar to
CPn0515.

Numerous hits in gapped BLAST to menaquinone and ubiquinone biosynthesis methyltransferase sequences, e.g., residues 7-226 are 25% similar to GRC2_BACSU. Residues 10-225 are 28% similar to UBIE_ECOLI. No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 10 clades of COG2226
COG name: Methylase involved in ubiquinone/menaquinone biosynthesis UbiE/COQ5
Functional Class:  H
The phylogenetic pattern of COG2226 is ----yqvcebr-uj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 13-34, 77-89, 106-150, 187-229 are significantly matched to blocks BL01183A,B,C,E, which encompass ubiE/COQ5 methyltransferase sequences, e.g. UBIE_ECOLI, GRC2_BACSU, GRC2_LACLA.

ProDom Summary:  Protein Domain Search
Residues 105-142 are 55% similar to a biotin synthesis-related domain of YIGO_ECOLI. Residues 77-144 are 37% similar to a domain from the hypothetical protein Y638_METJA.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 1 to 229 (E-value = 3.1e-15) place CT428 in the Ubie_methyltran family which is described as ubiE/COQ5 methyltransferase family (PF01209)

PDB Hit:
None.

Gene Protein Sequence:
MTDFHNKPNIQIMFDSLAPTYDKINGILSLGLHIAWNNALVSLLGETNHL
LDLCAGTGRVALSYVQNYPRASATLVDFSTKMLENVQKRHPSAPFSYITS
DVTHLPLPDNTFRLASMAYGLRNLSYPLEALREVYRVLQPGGHLGILELT
RPATYNPVYLLHKLYLNLVVPSVGRFYSGNSYAYSYLKESIRDLPRDAAL
EAIFHAAHLRPIRKRKLLFGTATIWILEK

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGACTTCCACAACAAGCCAAATATCCAAATCATGTTCGATTCTCT
TGCGCCTACCTATGATAAAATCAATGGTATTCTATCATTAGGCTTGCATA
TAGCTTGGAACAATGCTTTGGTTTCTCTCTTAGGAGAAACTAACCATCTA
TTAGATTTATGTGCAGGAACAGGCCGGGTAGCCCTATCTTATGTCCAGAA
CTATCCTCGAGCCTCAGCAACTCTTGTTGATTTCTCAACAAAAATGCTAG
AAAACGTCCAAAAACGCCACCCCTCAGCTCCATTCTCCTATATTACGAGT
GACGTAACACACTTGCCGCTTCCGGATAATACGTTTCGTTTAGCTTCTAT
GGCCTATGGATTACGGAACTTATCCTATCCATTAGAGGCTCTTAGGGAAG
TGTATCGAGTATTACAACCTGGAGGACACTTGGGTATTCTAGAACTGACA
CGCCCAGCAACATATAACCCAGTTTACCTGCTACACAAGCTCTATCTAAA
TCTTGTTGTTCCTAGCGTCGGCCGTTTTTATTCTGGGAACAGCTATGCTT
ATTCGTATCTGAAAGAAAGTATCCGGGATCTCCCACGCGATGCCGCTCTC
GAAGCAATCTTTCATGCAGCGCATTTACGCCCTATCCGGAAACGCAAACT
ACTTTTTGGCACAGCAACCATTTGGATTTTAGAGAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy