Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR356 IGR354 IGR355 IGR350 IGR352 IGR351 IGR353 dapF, - CT430 CT429 glyA, - CT432 rsbV, - CT424 CT422 ubiE, - CT428 CT426 tlyC_2, - CT423 CT425 dapF, - CT430 CT429 glyA, - CT432 rsbV, - CT424 CT422 ubiE, - CT428 CT426 tlyC_2, - CT423 CT425 dapF, - CT430 CT429 glyA, - CT432 clpP, - CT431 clpP, - CT431 rsbV, - CT424 CT422 ubiE, - CT428 CT426 tlyC_2, - CT423 CT425 CT427 CT427
* Calculated from Protein Sequence

Gene ID: CT426

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable biotin synthetase/lipoic acid synthetase

Gene Start:
495960

Gene Stop:
497066

Gene Length:
1107

Molecular Weight*:
41277

pI*:
7.08

Net Charge*:
0.47

EC:
2.8.1.6  

Functional Class:
cofactor biosynthesis; biotin and lipoic acid  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Biotin metabolism

Comment:
See CT770.

Biotin synthase catalyses the last step of the biosynthesis of biotin
in microorganisms and plants. The active protein isolated from
Bacillus sphaericus and Escherichia coli contains an iron-sulphur
(FeS) cluster (see Bui et al., FEBS Letters 440 (1-2): 226-230,
1998).

Biotin is an essential vitamin for microorganisms. It is a carrier of
activated CO2 and hence plays critical roles in carboxylase-catalyzed
reactions and hence plays a crucial role in gluconeogenesis and in
maintaining the level of citric acid cycle intermediates (see
"[2FE-2S] TO [4FE-4S] CLUSTER CONVERSION IN ESCHERICHIA-COLI BIOTIN
SYNTHASE." 1997. DUIN EC, LAFFERTY ME, CROUSE BR, ALLEN RM, SANYAL I,
FLINT DH, JOHNSON MK. BIOCHEMISTRY 36(39): 11811-11820).

Blast Summary:  PSI-Blast Search
Numerous hits to hypothetical protein sequences from bacteria, e.g., residues
21-366 are 34% similar to a hypothetical protein from A.fulgidus (AE001077).
Residues 25-366 are 29% similar to YE31_METJA. Some hits are to putative biotin
synthetase proteins, e.g., residues 29-364 are 17% similar to this enzyme from M.
thermoautotrophicum. No similarities to T.pallidum or M.genitalium.

CT426 is orthologously related to CPn0513: residues 10-369 of CT426
are 64% similar to residues 9-369 of CPn0513, a predicted biotin
synthetase/lipoic acid synthetase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1060
COG name: Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes
Functional Class:  H,R
The phylogenetic pattern of COG1060 is AMTk-QVCe-r-UJ----IN-
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 108-129 are matched to block PR00670B, which consists of inhibin
beta A chain signatures, e.g., IHBA_HORSE.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CT426 is paralogously related to CT767, thought to be a THIM_like protein:
residues 24-335 are 33% similar to CT767.

Pfam Summary:  Pfam Search
Residues 71 to 244 (E-value = 3.6e-16) place CT426 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

PDB Hit:
none

Gene Protein Sequence:
MTTLPARILPKSACLKTLFDDYLSGARLSEEQALQLLLVDAEDQQALWSF
ADLIRANRVGDTVFYSSTLYLYPTNFCQFNCTFCSFYAKPGNPTGWFFTP
DQLVQSIKENPSPITETHIVAGCYPSCNLAYYEELFSKIKQNFPDLHIKA
LSAIEYDYLSKLDNLPVKEVMQRLRIAGLDSIPGGGAEILVDEVRETLSR
GRLSSQGFLEIHETAHSLGIPSNATMLCYHRETPADIMTHMSKLRALQDK
TSGFKNFILLKFASENNALGKRLHKMTSRHSIPPATIIAVARLFLDNIPN
IKALWNYLGLDVALHLLSCGANDLSSTHQGEKVFRMASSQEPIRMDIEGM
SHLIIQHGRIPCLVNSKTV

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGACTCTTCCAGCTCGAATCCTACCTAAAAGCGCATGTCTTAAAAC
TTTATTTGATGACTATTTATCTGGAGCGCGTCTTTCTGAAGAACAAGCTT
TACAATTACTTCTCGTTGATGCTGAGGATCAACAAGCTTTATGGAGCTTT
GCTGATCTTATTCGTGCCAATCGTGTTGGTGACACAGTTTTCTACTCGTC
GACCCTTTATTTATACCCTACAAACTTCTGTCAGTTTAACTGTACGTTTT
GTTCTTTCTATGCCAAACCAGGGAACCCTACAGGATGGTTCTTTACTCCA
GATCAACTCGTACAATCTATAAAAGAAAACCCTTCTCCCATTACAGAAAC
GCATATTGTAGCAGGATGCTACCCCTCTTGTAATCTTGCTTACTATGAAG
AGCTCTTCTCCAAAATTAAGCAAAATTTCCCAGATCTACATATTAAAGCG
CTCTCAGCTATCGAGTATGATTATCTGTCAAAATTAGACAATCTCCCAGT
TAAAGAAGTCATGCAACGCTTGCGTATCGCTGGCCTTGATTCTATTCCTG
GTGGGGGTGCTGAGATCTTAGTCGATGAAGTCCGAGAGACCCTCTCGCGA
GGCAGATTATCTTCCCAAGGATTCTTAGAGATCCATGAAACAGCGCATTC
CTTAGGAATCCCTAGCAATGCTACCATGCTGTGCTACCATCGAGAGACTC
CTGCAGATATAATGACACATATGAGTAAACTGCGCGCTCTTCAAGACAAA
ACTTCTGGCTTTAAGAATTTTATCCTCCTCAAATTTGCGTCAGAGAATAA
TGCTTTAGGAAAGCGTCTACACAAAATGACTTCAAGACACTCGATTCCTC
CTGCAACTATTATTGCAGTTGCTCGACTATTCCTAGACAACATCCCTAAT
ATTAAAGCTCTATGGAATTATTTAGGTCTCGACGTTGCTCTACACTTGTT
ATCATGCGGAGCCAATGATTTGTCTTCCACTCACCAAGGAGAAAAGGTAT
TTCGAATGGCCTCTTCCCAAGAGCCTATTCGTATGGATATTGAAGGGATG
TCCCATCTCATAATACAACATGGTCGTATCCCATGCTTAGTCAATTCCAA
GACCGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy