Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR338 IGR337 IGR341 IGR339 IGR342 IGR340 IGR336 ribC, - CT405 CT404 dksA, - CT407 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 lpxB, - CT411 pmpA, - CT412 ribC, - CT405 CT404 dksA, - CT407 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 lpxB, - CT411 pmpA, - CT412 CT404 ribC, - CT405 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 lpxB, - CT411 pmpA, - CT412 dksA, - CT407
* Calculated from Protein Sequence

Gene ID: CT410

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pcnB  

Definition:
poly(A) polymerase (PAP)/tRNA nucleotidyltransferase

Gene Start:
468008

Gene Stop:
469282

Gene Length:
1275

Molecular Weight*:
49365

pI*:
9.18

Net Charge*:
9.86

EC:
2.7.7.19  

Functional Class:
transcription; RNA modification  

Pathway: pathway table

Comment:
The polyA polymerase adds the 3'polyA tail to messages; it belongs to the
tRNA nucleotidyltransferase/polyA polymerase (PAP) family. It somehow
affects plasmid copy number in E.coli, where it is a monomer.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to polyA polymerase (PAP), plasmid copy protein, tRNA
nucleotidyltransferase sequences, e.g., residues 28-410 are 34% similar to PCNB_ECOLI.
CT410 is similar to TP0596 and TP0270 of T.pallidum. No similarity to
M.genitalium.

CT410 is orthologously related to CPn0966: residues 2-421 of CT410
are 68% similar to residues 1-418 of CPn0966, polyA polymerase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0617
COG name: tRNA nucleotidyltransferase/poly(A) polymerase
Functional Class:  J
The phylogenetic pattern of COG0617 is ----yQvCEbrHuj--oLINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 154-171 are matched to block PR00351F, which contains protein import
receptor signature sequences, e.g., OM20_NEUCR.

ProDom Summary:  Protein Domain Search
Residues 46-122 are 64% similar to a polymerase PAP A poly domain as observed in
PCNB_HAEIN. Residues 140-213 are similar to a domain found in
tRNA CCA pyrophosphorylase sequences, e.g., PCNB_ECOLI.

Paralogs:  Local Blast Search
CT410 is paralogously related to CT704, thought to be a polyA polymerase:
residues 40-264 are 38% similar to this protein.

Pfam Summary:  Pfam Search
Residues 118 to 272 (E-value = 1.5e-71) place CT410 in the PolyA_pol family which is described as Poly A polymerase family (PF01743)

PDB Hit:
none

Gene Protein Sequence:
MMACNQELLSPRGLDLLSKNSHSNLTPTIFYPSDHNIDLQSFSTHALSVV
RTLKKAGYEAYIVGGCIRDLLLKTEPKDFDISTSAKPEEVKTLFKNCILV
GKRFRLAHIRFPNQIIEVATFRSGSNEEDSLITKDNLWGSAEEDVLRRDF
TINGLFYDPSAEIIIDYTGGVEDLKNRYLRTIGDPFLRFKQDPVRMLRLL
KILSRYAFTVDPKTLEALQESCHELVKSSQPRVFEEIIKVLSSGESTIFF
QLASEHRVLEILFPYMAKAFSLSKTLQDQTFACLTALDTKIQKRSFCSER
HFLLAILLFPIVNFNVRYKYSQYPTMTIQSIFDYIRNFLTEFFADSFTSC
SKKNFILTTLLLQMQYRLTPLNAMKKEKKSFFNRRLLRHAYFREALYLLE
IRSKVYPKVEATYGEWLKHYELASE

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGGCTTGCAACCAAGAACTTCTTTCGCCTAGAGGCTTAGATTTGCT
CAGCAAAAATTCTCATTCTAATCTTACTCCTACGATATTTTATCCATCAG
ACCACAATATTGATCTGCAAAGTTTCTCCACTCACGCGCTTTCCGTTGTA
AGAACTTTGAAAAAAGCTGGGTACGAAGCTTACATTGTCGGAGGCTGTAT
CCGAGACCTGTTGTTGAAGACAGAACCAAAAGATTTTGATATCTCAACCT
CTGCTAAACCTGAAGAAGTCAAAACGTTATTCAAAAATTGTATTCTTGTA
GGCAAACGATTTCGTTTGGCTCACATCCGTTTCCCAAACCAAATCATAGA
GGTCGCTACCTTTAGATCTGGTAGCAACGAAGAAGACTCCTTAATTACAA
AAGATAATCTTTGGGGATCTGCCGAAGAAGACGTATTACGCAGAGACTTC
ACGATTAACGGCCTTTTTTATGACCCTAGCGCAGAAATTATCATCGACTA
CACAGGCGGTGTTGAGGATTTAAAAAATCGCTATCTCAGAACTATTGGAG
ATCCTTTCCTTCGTTTCAAACAAGATCCTGTGCGCATGCTGCGCCTATTA
AAAATTTTATCTCGTTATGCTTTTACAGTAGATCCTAAAACTCTAGAAGC
TCTTCAAGAATCTTGTCACGAACTTGTGAAAAGCTCTCAACCTCGAGTCT
TTGAAGAAATCATCAAAGTCTTGAGTTCTGGGGAGTCTACCATTTTTTTC
CAGCTAGCTTCCGAACATCGAGTCCTAGAGATTTTATTCCCTTACATGGC
TAAGGCATTTAGCTTAAGTAAGACTCTGCAAGATCAGACTTTCGCTTGCT
TAACAGCATTAGACACTAAAATTCAGAAACGCTCGTTCTGTTCAGAAAGA
CACTTTCTGCTGGCGATCCTATTATTCCCTATTGTTAACTTCAATGTGCG
GTACAAATATAGTCAATACCCAACGATGACTATCCAAAGTATCTTTGACT
ATATTCGAAACTTTTTGACTGAATTTTTTGCCGACTCATTTACTAGTTGT
TCCAAGAAAAATTTCATCTTGACAACTCTGCTATTGCAAATGCAGTACCG
GCTGACCCCATTGAATGCTATGAAGAAAGAAAAAAAATCTTTCTTCAATA
GAAGATTGTTACGCCATGCCTACTTCCGAGAAGCTCTTTACTTACTAGAA
ATCCGCAGTAAAGTGTATCCAAAAGTAGAGGCTACCTATGGAGAGTGGCT
TAAACATTATGAATTAGCATCGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy