Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR338 IGR337 IGR335 IGR341 IGR339 IGR340 IGR336 ribC, - CT405 CT404 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 lpxB, - CT411 ribC, - CT405 CT404 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 lpxB, - CT411 ribC, - CT405 CT404 gltT, - CT401 ycaH, - CT402 spoU, - CT403 spoU, - CT403 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 lpxB, - CT411 dksA, - CT407
* Calculated from Protein Sequence

Gene ID: CT408

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lspA  

Definition:
prolipoprotein signal peptidase (LSPA-related)

Gene Start:
465827

Gene Stop:
466327

Gene Length:
501

Molecular Weight*:
18923

pI*:
10.66

Net Charge*:
10.84

EC:
3.4.23.36  

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane Transport; Type II secretion system

Comment:
The LSPA enzyme removes signal peptides from prolipoproteins.

From Prosite PDOC00669:

Signal peptidases (SPases) (also known as leader peptidases) remove the signal peptides from secretory proteins. In prokaryotes three types of SPases are known: type I (gene lepB) which is responsible for the processing of the majority of exported pre-proteins; type II (gene lsp) which only process lipoproteins, and a third type involved in the processing of pili subunits.

SPase II (EC 3.4.23.36), also known as lipoprotein signal peptidase, recognizes a conserved sequence and cuts in front of a cysteine residue to which a glyceride-fatty acid lipid is attached. SPase II is an integral membrane protein that is anchored in the cytoplasmic membrane.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to lipoprotein signal peptidases, e.g.,
residues 18-165 are 34% similar to LSPA_SYNY3. CT408 is weakly similar to TP0978 of
T.pallidum, a predicted signal peptidase II. No similarity to
M.genitalium.
CT408 is orthologously related to CPn0535: residues 1-165 are 53% similar to CPn0535.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0597
COG name: Lipoprotein signal peptidase
Functional Class:  N
The phylogenetic pattern of COG0597 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 51-74, 101-126, 136-155 are significantly matched to blocks
BL00855A,B,C, which encompass signal peptidase sequences, e.g., LSPA_HELPY,
LSPA_STAAU, LSPA_SYNY3.

ProDom Summary:  Protein Domain Search
Residues 100-149 are 50% similar to a signal peptidase II domain as
observed in LSPA_STACA. Residues 53-136 are more weakly associated with a
urease operon domain illustrated by URED_HELPY.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 7 to 166 (E-value = 1.4e-13) place CT408 in the Peptidase_A8 family which is described as Signal peptidase (SPase) II (PF01252)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
40  
59
transmembrane  
65  
89
transmembrane  
104  
123
transmembrane  
141  
157

PDB Hit:
none

Gene Protein Sequence:
MPTRSLPTFLTLLLLASIDWVSKLVVLLKSCQLSPHSSAFLYSYVWGHFS
FLIIPSFNEGAAFGLFTQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTR
VALTLILAGALGNVGDILLYGKVVDFLSLSYYSWRFPSFNLADAFISIGT
LLLIGHLYFTKESKKYF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGACCCGTTCTCTCCCAACCTTCCTTACTCTCCTTCTCCTAGCCTC
TATTGATTGGGTCTCAAAACTAGTTGTGTTACTCAAGAGCTGCCAGCTCT
CCCCTCACTCCTCAGCTTTTCTTTATAGCTACGTGTGGGGACATTTTTCT
TTTCTCATTATTCCCTCCTTCAATGAAGGAGCAGCCTTTGGACTCTTTAC
TCAATACAAAATCCCTCTTCTTATTTTCCGCGTTTGCGTAATCCTAGGCC
TAGCCTTATTCTTGAGAATTAAATATAAGTCTTTACACAGAAGAACACGA
GTTGCTTTAACCTTGATCCTCGCTGGAGCTCTAGGGAATGTGGGTGATAT
CTTACTCTACGGTAAGGTTGTCGACTTCCTTTCTCTTAGCTATTACTCCT
GGCGCTTTCCTTCCTTCAATTTAGCAGATGCGTTTATCTCTATAGGAACC
CTCCTTCTTATTGGTCACCTATACTTCACTAAAGAAAGTAAAAAATACTT
T


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy