Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR338 IGR337 IGR335 IGR339 IGR340 IGR334 IGR336 ribC, - CT405 CT404 sucB, - CT400 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 ribC, - CT405 CT404 sucB, - CT400 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 ribC, - CT405 CT404 sucB, - CT400 gltT, - CT401 ycaH, - CT402 spoU, - CT403 spoU, - CT403 CT406 lspA, - CT408 pcnB, - CT410 dagA, - CT409 dksA, - CT407
* Calculated from Protein Sequence

Gene ID: CT405

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribC  

Definition:
riboflavin synthase alpha subunit

Gene Start:
464576

Gene Stop:
463980

Gene Length:
597

Molecular Weight*:
22207

pI*:
6.52

Net Charge*:
-1.65

EC:
2.5.1.9  

Functional Class:
cofactor biosynthesis; riboflavin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Riboflavin metabolism

Comment:
Riboflavin synthase is necessary for the synthesis of riboflavin from
5-amino-6-(1'-D)-ribityl-amino-2,4 pyrimidinedione. In B.subtilis, the
enzyme consists of 3 alpha subunits and 60 beta subunits. The alpha subunit
is reported to separately catalyze the formation of riboflavin from
6,7-dimethyl-8-lumazine. An Xray crystallographic structure is available.
See CT732 for the beta chain sequence. See also CT730 and CT731.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to riboflavin alpha chain sequences, e.g., residues
1-188 are 36% similar to RISA_ACTPL. No similarities to T.pallidum or
M.genitalium.

CT405 is orthologous to CPn0532: residues 1-193 are 47% similar to CPn0532.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0307
COG name: Riboflavin synthase alpha chain
Functional Class:  H
The phylogenetic pattern of COG0307 is ----yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 1-199 possess stretches that match blocks BL00693A,B,C,D,E,
which encompass riboflavin synthase sequences, e.g. RISA_ACTPL, RISA_BACSU,
RISA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 98-176 are 50% similar to a riboflavin alpha chain domain as
observed in RISA_HAEIN. Residues 3-83 support this, as seen in the similarity to
RISA_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 85 (E-value = 2.5e-12) place CT405 in the Lum_binding family which is described as Lumazine binding domain (PF00677)
Residues 98 to 178 (E-value = 4.8e-26) place CT405 in the Lum_binding family which is described as Lumazine binding domain (PF00677)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
101  
118
transmembrane  
123  
145

PDB Hit:
none

Gene Protein Sequence:
MFSGIIQEVARVDLIHHLRDSMEIGVFARKLIDVVPGSSFSVDGICLTLV
KRQYELLFFDVTEETMAWTTIKDYTVGTMVNLERSVRLGDEIGGHFVSGH
VCGIGTIIAIEKSYMFFKAPANLVPYILEKGFIAIDGISLTIARVKGDIF
SVSLIPETRARTSLGYKQVGAHVNMEPDMMTKMQVDTIMRFHAEKEISK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCAGGCATTATTCAAGAAGTCGCACGGGTAGATCTTATTCACCA
TCTCAGGGATTCCATGGAGATTGGAGTTTTTGCTCGCAAGTTGATCGATG
TGGTTCCGGGGAGTAGCTTCTCTGTCGATGGCATATGTTTGACTCTGGTC
AAACGACAGTACGAATTACTCTTTTTTGATGTGACTGAAGAAACCATGGC
TTGGACTACCATCAAAGATTATACGGTGGGAACCATGGTAAATTTAGAAC
GCTCGGTTCGATTAGGAGATGAAATAGGAGGACATTTTGTCTCTGGGCAT
GTCTGTGGGATAGGCACTATTATTGCTATAGAGAAATCCTATATGTTTTT
TAAGGCTCCAGCTAATTTAGTGCCTTATATTTTAGAGAAAGGCTTCATTG
CTATTGATGGCATCAGTTTGACAATTGCACGAGTTAAAGGGGACATCTTT
TCAGTTAGTTTGATTCCGGAGACTCGAGCGCGCACCTCATTGGGTTATAA
ACAGGTGGGTGCTCACGTGAATATGGAGCCTGATATGATGACAAAAATGC
AGGTGGACACAATTATGCGTTTCCATGCCGAAAAAGAGATCAGCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy