Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR338 IGR337 IGR335 IGR333 IGR339 IGR334 IGR336 ribC, - CT405 CT404 CT399 sucB, - CT400 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 dagA, - CT409 ribC, - CT405 CT404 CT399 sucB, - CT400 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 dagA, - CT409 ribC, - CT405 CT404 CT399 sucB, - CT400 gltT, - CT401 ycaH, - CT402 spoU, - CT403 spoU, - CT403 CT406 lspA, - CT408 dagA, - CT409 dksA, - CT407
* Calculated from Protein Sequence

Gene ID: CT403

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoU  

Definition:
23S rRNA methyltransferase

Gene Start:
463165

Gene Stop:
462359

Gene Length:
807

Molecular Weight*:
30181

pI*:
5.87

Net Charge*:
-2.60

EC:
2.1.1.-  

Functional Class:
transcription; RNA modification  

Pathway: pathway table

Comment:
Belongs to the SpoU family of rRNA methylases.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to rRNA methylases, e.g. residues 8-263 are
29% similar to the enzyme from Synechocystic (D90913). CT403 is weakly similar to TP0109 in T.pallidum, a predicted rRNA
methylase. It is also similar to MG252 in M.genitalium.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0566
COG name: rRNA methylases
Functional Class: J
The phylogenetic pattern of COG0566 is a---YQvCEBRHujgpOLinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 94-247 are 31% similar to a methyltransferase domain of YACO_BACSU.
Residues 128-263 are 25% similar to a domain of SPOU_ECOLI.

Paralogs:  Local Blast Search
CT403 is weakly paralogous to CT540, a predicted rRNA methylase.

Pfam Summary:  Pfam Search
Residues 117 to 257 (E-value = 1.1e-23) place CT403 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

PDB Hit:
none

Gene Protein Sequence:
MEFIGKNNARVKSALALKRQRARNSTYFLLEGFREIHRALISGYRCSHVF
CGELIADKEIALDRELTSLGIEKLYCSKDILEKLSFKENPENFIAVFEKK
ELSCQEFLGLQRKNQAPFYLIVEQAEKPGNIGALLRIADGAGVDGVILCD
PVVDLYNPNVIRSSLGTVFTMPVWQASLKEVLDLVHQQEWQVFTTTPSAQ
TFYFDQDFCQPMVVVFGSEKDGLSPDWLNGSFCNIALPMLGKADSLNLSS
SVAAVAYEVVRQRSIRNLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGTTTATAGGGAAAAATAATGCCCGTGTTAAGAGTGCTCTTGCTTT
AAAGCGCCAGCGGGCACGTAATAGCACATATTTTTTATTAGAAGGGTTTC
GAGAGATTCATCGAGCCCTAATTTCTGGATACCGTTGTTCGCATGTATTT
TGCGGAGAACTAATTGCCGATAAGGAGATAGCTCTTGATCGCGAGCTTAC
TTCGCTTGGTATTGAAAAGTTGTATTGTTCTAAGGATATTTTGGAAAAAC
TGTCGTTTAAAGAGAATCCCGAGAATTTTATTGCTGTTTTTGAAAAGAAA
GAGCTGTCTTGCCAAGAGTTTTTAGGATTGCAGCGAAAGAATCAGGCTCC
TTTTTATTTGATTGTTGAGCAAGCAGAAAAACCTGGAAATATAGGAGCTT
TGCTAAGGATCGCAGATGGAGCAGGGGTGGATGGAGTCATTCTTTGTGAT
CCTGTAGTCGATTTATACAATCCCAATGTAATTCGTTCCTCTTTAGGTAC
AGTATTCACTATGCCTGTTTGGCAAGCTTCTTTGAAAGAGGTCTTGGATT
TGGTTCATCAACAAGAATGGCAGGTTTTCACAACAACTCCATCAGCACAA
ACTTTTTATTTTGATCAAGATTTTTGCCAACCGATGGTTGTGGTGTTTGG
CTCAGAAAAAGATGGGCTGTCGCCTGATTGGTTGAATGGAAGTTTTTGTA
ACATAGCTTTACCTATGTTAGGGAAAGCAGATTCATTAAACCTTTCTTCT
TCTGTTGCGGCTGTTGCTTATGAGGTCGTTCGACAAAGAAGTATAAGAAA
TCTTTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy