Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR338 IGR337 IGR335 IGR333 IGR339 IGR334 IGR336 IGR332 ribC, - CT405 CT404 CT399 sucB, - CT400 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 CT398 dagA, - CT409 ribC, - CT405 CT404 CT399 sucB, - CT400 gltT, - CT401 ycaH, - CT402 dksA, - CT407 CT406 lspA, - CT408 CT398 dagA, - CT409 ribC, - CT405 CT404 CT399 sucB, - CT400 gltT, - CT401 ycaH, - CT402 spoU, - CT403 spoU, - CT403 CT406 lspA, - CT408 CT398 dagA, - CT409 dksA, - CT407
* Calculated from Protein Sequence

Gene ID: CT402

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ycaH  

Definition:
probable tetraacyldisaccharide 4'kinase

Gene Start:
462340

Gene Stop:
461084

Gene Length:
1257

Molecular Weight*:
46737

pI*:
10.35

Net Charge*:
20.99

EC:
2.7.1.130  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Comment:
Possible ATPase (ycaH). In E.coli, this enzyme transfers the gamma phosphate of ATP
to the 4' position of tetraacyldisaccharide 1-phosphate (DS-1-P) as part of
lipid A biosynthesis.


Blast Summary:  PSI-Blast Search
A few hits in gapped BLAST to tetraacyldisaccharide 4'-kinase sequences and to hypothetical
proteins, e.g. residues 76-380 are 26% similar to LPXK_HAEIN. I

CT402 is orthologously related to CPn0529: residues 80-415 of CT402
are 51% similar to residues 29-363 of CPn0529, a predicted
tetraacyldisaccharide 4'kinase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1663
COG name: Lipid A biosynthesis protein LpxK, tetraacyldisaccharide-1-P 4'-kinase
Functional Class:  N
The phylogenetic pattern of COG1663 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 76-350 are 27% similar to a hypothetical domain of YCAH_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 61 to 413 (E-value = 3.7e-224) place CT402 in the LpxK family which is described as Tetraacyldisaccharide-1-P 4'-kinase (PF02606)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
77  
95
transmembrane  
314  
332

PDB Hit:
None.

Gene Protein Sequence:
MIFNVLYAILRDTLVWKATWVKRTKSLSQPFRVVIVFAGCSFRKNLSRAP
MRFSFFSGIRDLFRHLIISATSGALSDRLGWLWAVIARVFSGSVWLRHKI
AKSPHQVQATVVSVGNIVVGGTGKTPLVLWLAQALHERGLSCAVLSRGYK
GKYSKKKAFTIVNPALHTASCVGDEPLLLAKYLPSGTVRIQKDRKTLAEK
SAGDFDVLLLDDGFQYNRLHKDVEIVLVNGSDPFGGGSFFPKGRLRDFPE
RLAKADYVMINGRCSPSDQRELDRLHPEEKIVIEPQISEIVWLNQSVNMP
RDHWEGLGVGVFCGLGFPKGFLAMLRDAGIHVLGTYLLPDHVGITKQELE
LFCKKIILRQGVGILCTEKDSVKIGALAEEISFPVGEVRMRFSCVCNERR
MVAMLDAIEAIQKNKRVTT

Gene Nucleotide Sequence:  Sequence Viewer
TTGATTTTTAATGTTTTATATGCGATCCTTCGGGATACCCTCGTTTGGAA
GGCTACTTGGGTAAAGAGGACGAAGAGTCTGTCTCAGCCCTTTAGGGTTG
TCATAGTTTTTGCAGGTTGTTCGTTTAGGAAGAACTTGAGTAGGGCGCCC
ATGAGATTCAGTTTCTTTTCTGGTATTCGAGACCTTTTCCGTCATCTCAT
CATATCTGCGACTTCTGGAGCCTTGTCTGATCGTTTAGGCTGGCTTTGGG
CAGTCATAGCTAGAGTGTTTTCTGGCTCTGTTTGGCTGCGACATAAGATT
GCGAAATCTCCTCATCAAGTACAAGCAACAGTGGTGAGTGTAGGGAATAT
CGTTGTTGGCGGGACAGGAAAGACTCCTTTGGTGTTATGGCTAGCCCAAG
CACTGCATGAAAGAGGGCTTTCTTGTGCGGTGCTTTCGAGAGGATACAAA
GGGAAATATAGTAAGAAAAAAGCATTTACTATTGTGAATCCAGCGCTTCA
CACCGCTTCTTGTGTTGGAGATGAACCTTTGCTCTTAGCCAAGTATTTGC
CGTCAGGGACGGTACGGATACAAAAGGACCGAAAAACCCTTGCGGAGAAG
AGTGCTGGGGATTTTGATGTTTTGTTGTTGGACGACGGATTTCAATACAA
TCGCCTTCATAAAGATGTAGAGATTGTATTAGTGAATGGTTCGGATCCTT
TTGGAGGAGGCTCTTTTTTCCCAAAAGGAAGACTTCGAGACTTCCCAGAA
AGATTGGCGAAGGCGGATTACGTCATGATTAATGGTAGATGTTCGCCTTC
CGATCAACGCGAGTTGGATCGATTGCACCCCGAAGAGAAGATCGTGATCG
AGCCTCAGATTTCGGAAATTGTTTGGTTGAATCAATCTGTAAACATGCCT
CGAGATCATTGGGAAGGTCTAGGTGTGGGGGTATTTTGTGGGTTAGGGTT
TCCTAAAGGATTCTTAGCTATGTTAAGAGATGCAGGGATTCATGTTTTAG
GTACGTATCTATTACCTGACCATGTGGGCATAACAAAGCAAGAGTTAGAA
CTTTTTTGTAAGAAAATCATTTTGCGCCAAGGAGTTGGTATCCTGTGTAC
AGAAAAGGATAGCGTAAAAATAGGAGCGCTTGCTGAAGAAATATCATTCC
CGGTTGGAGAAGTCCGCATGCGGTTTTCTTGCGTTTGCAATGAAAGACGA
ATGGTGGCCATGTTGGATGCAATAGAAGCCATCCAGAAGAATAAGAGGGT
AACTACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy