Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR325 IGR326 IGR322 IGR329 IGR328 IGR324 IGR323 IGR327 CT388 yprS, - CT392 grpE, - CT395 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 dnaK, - CT396 CT387 CT388 yprS, - CT392 grpE, - CT395 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 dnaK, - CT396 CT387 CT388 yprS, - CT392 grpE, - CT395 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 dnaK, - CT396 CT387
* Calculated from Protein Sequence

Gene ID: CT392

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yprS  

Definition:
Chlamydia-specific hypothetical protein

Gene Start:
447826

Gene Stop:
446696

Gene Length:
1131

Molecular Weight*:
41437

pI*:
5.11

Net Charge*:
-12.74

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAC67989. YPRS_CHLTR has been described as a GrpE-like protein with homology to heat shock proteins of B.subtilis and Clostridium acetobutylicum. See CT394.

Blast Summary:  PSI-Blast Search
CT392 is weakly related to CPn0499, a Chlamydia-specific protein: residues 1-374 are 24% similar to CPn0499.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-377 are identical to the 41.4 kD hypothetical protein ProS of O84397_CHLTR. Shows identity to YPRS_CHLTR.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
76  
113
non-globular  
114  
187
non-globular  
300  
377

PDB Hit:
None.

Gene Protein Sequence:
MSSIQGTSGSSPERLPNSREDEGMNPEGVTPSGQTISFSAVGKSTSAEDI
QQLALPIIQSDAMASSPSVGGAVGEVEVAEIIADVMEKNDANVQKLDEDM
EALLQAISSSEEQLESPGVRNKSALKGTNRSNSHREEIARNQRLRSLSVR
HGLAYNRHSLRRLARGIRHHAGLVTASFATLHKTLRAVPQEDLKSILGKD
SDTVLARLHKLGLEVNEKGEWRLRANGEVGSINQSICNLARSAERLHDDG
PLSINDQASEEEVTACCSAGRRACQFLQEHLMGALRAIYYQILRFFHWIS
RRVEVEPEDTDYYMRPGIFINPYASYLSSSPSVEDPRSLRDRLRDGGALS
GEDTLFSMPQDESLDSESVSDDDRGFQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCTATACAAGGAACATCGGGTTCTTCCCCTGAGAGGCTTCCCAA
TTCTAGGGAAGACGAGGGGATGAATCCCGAAGGGGTCACACCCTCTGGTC
AGACTATTTCTTTCTCTGCTGTAGGGAAGAGTACCTCTGCAGAAGATATT
CAGCAGCTTGCACTTCCGATTATTCAGTCGGATGCAATGGCATCTTCTCC
AAGTGTGGGAGGAGCAGTTGGCGAGGTTGAAGTCGCTGAGATCATCGCGG
ATGTAATGGAGAAGAACGACGCGAACGTGCAGAAACTGGATGAAGACATG
GAAGCTCTACTGCAAGCGATTTCTTCTAGTGAAGAGCAGCTAGAGTCTCC
TGGGGTAAGAAATAAGAGCGCTCTGAAAGGAACGAATCGTTCTAATTCTC
ATCGAGAAGAGATAGCTAGAAACCAGAGACTCCGCTCCCTTTCTGTTCGT
CATGGGCTTGCGTATAACCGACATTCATTAAGAAGATTAGCTAGAGGAAT
ACGTCATCACGCAGGACTAGTAACCGCGTCTTTTGCAACACTACATAAAA
CGCTTCGTGCAGTTCCTCAAGAAGATCTCAAGTCCATTTTAGGTAAGGAT
AGCGATACGGTTCTAGCTCGCTTACATAAGTTAGGATTAGAGGTCAATGA
GAAAGGGGAGTGGAGACTTCGAGCCAACGGAGAGGTCGGCTCTATTAATC
AATCTATCTGCAACTTAGCTCGTTCTGCGGAACGTTTACATGATGACGGA
CCTTTGAGCATCAATGACCAAGCTTCTGAAGAGGAGGTAACGGCATGCTG
TTCTGCAGGAAGAAGAGCCTGTCAGTTTTTGCAAGAGCATTTAATGGGTG
CTTTGCGAGCCATTTACTACCAGATCTTGCGTTTCTTTCATTGGATATCG
AGGAGGGTAGAGGTTGAGCCTGAGGACACAGACTATTACATGCGTCCAGG
CATATTCATTAACCCTTACGCGTCGTATTTAAGTTCTAGTCCTTCTGTGG
AAGACCCTCGTTCTCTACGGGACCGCTTGCGGGATGGGGGAGCTCTGTCC
GGAGAGGATACTCTATTCTCTATGCCTCAAGATGAGAGTTTAGATTCGGA
ATCCGTTTCCGATGATGATAGAGGATTTCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy