Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR325 IGR326 IGR322 IGR328 IGR324 IGR323 IGR327 CT388 yprS, - CT392 grpE, - CT395 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 CT387 CT388 yprS, - CT392 grpE, - CT395 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 CT387 CT388 yprS, - CT392 grpE, - CT395 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 CT387
* Calculated from Protein Sequence

Gene ID: CT391

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
445680

Gene Stop:
446684

Gene Length:
1005

Molecular Weight*:
36856

pI*:
7.05

Net Charge*:
0.22

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein is identical to GenBank accession AAC67988.

Blast Summary:  PSI-Blast Search
CT391 is orthologously related to CPn0496, a Chlamydia-specific hypothetical protein: residues 2-323 are 54% similar to CP0496.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 35 to 322 (E-value = 2.3e-131) place CT391 in the DUF534 family which is described as Protein of unknown function (DUF534) (PF04392)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26

PDB Hit:
None.

Gene Protein Sequence:
MLLRKFCGYLFCSSLVCSFISVIVVSFRSEPITPSVAIFSSFSHNSLSEC
IESCQKELTSFGNMPTISLFNSEDNVVKARKIARTLHKDPNVVMIITLGP
IATKVMSQIETQKPIIYAVVPAGEALRFPKEQVNIYGVNDSVDTNQCCFA
IHAVTNNANSLVYLQPHEPFPSSLQEEITNKLRASGIKVTELPISAANMS
SRIQFIAENRPSAVFFPLSSLSEKMGTTLIKSILKENIPLITDDSSLVME
GACAACSVDYKLSGKQIACIVRYLLSKKNNEEHLNQISAEPILSKITFNE
EIIRFLGLPFNVAPAHQFISFHSADNTGLVTLQIP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTTTGCGAAAATTTTGTGGCTATCTTTTTTGTAGTTCCCTAGTTTG
TTCTTTTATTTCCGTCATTGTTGTTTCCTTTCGTTCAGAACCAATAACGC
CTAGCGTTGCTATCTTCTCTTCCTTTTCCCATAATTCTCTTAGTGAATGC
ATAGAGAGTTGTCAAAAAGAACTGACCAGCTTTGGGAACATGCCCACTAT
CTCCCTATTTAATTCTGAGGATAATGTAGTCAAAGCAAGAAAAATCGCTC
GCACCCTTCATAAAGACCCTAATGTTGTCATGATCATTACTTTAGGCCCC
ATTGCAACTAAAGTAATGAGTCAAATCGAAACACAAAAACCGATCATTTA
TGCTGTTGTCCCTGCAGGAGAAGCTCTCCGATTCCCAAAAGAGCAGGTTA
ATATATACGGGGTTAATGATAGCGTAGACACAAACCAATGTTGTTTCGCG
ATTCATGCGGTAACCAACAACGCGAATTCGTTGGTTTATCTACAACCCCA
CGAACCTTTCCCTTCTTCCTTACAGGAAGAAATTACAAATAAACTCCGCG
CGTCAGGCATTAAAGTGACAGAACTTCCTATTTCTGCAGCCAACATGTCG
TCTCGCATTCAGTTTATTGCAGAAAATCGTCCTTCCGCAGTCTTTTTCCC
TCTTTCTTCCCTATCAGAAAAAATGGGAACGACGCTCATTAAAAGCATCT
TAAAAGAAAATATTCCTCTGATCACAGATGACTCTTCCCTTGTTATGGAA
GGTGCTTGTGCAGCATGTAGCGTTGATTATAAACTATCAGGCAAACAAAT
AGCCTGTATCGTTCGTTATTTGCTCAGCAAGAAAAACAATGAAGAGCATT
TGAACCAGATTAGCGCAGAGCCGATCCTTTCCAAAATTACTTTCAATGAG
GAAATTATCCGGTTCTTAGGACTTCCATTTAATGTGGCTCCGGCTCACCA
ATTTATCTCTTTCCACTCTGCAGATAATACTGGATTAGTGACTTTACAAA
TCCCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy