Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR325 IGR326 IGR322 IGR328 IGR324 IGR323 IGR327 IGR321 CT388 CT386 yprS, - CT392 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 CT387 CT388 CT386 yprS, - CT392 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 CT387 CT388 CT386 yprS, - CT392 CT391 hrcA, - CT394 aspC, - CT390 CT389 proS, - CT393 CT387
* Calculated from Protein Sequence

Gene ID: CT390

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspC  

Definition:
aspartate aminotransferase

Gene Start:
444470

Gene Stop:
445669

Gene Length:
1200

Molecular Weight*:
44711

pI*:
5.49

Net Charge*:
-8.10

EC:
2.6.1.1  

Functional Class:
amino acid biosynthesis; aspartate family, glutamate  
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Energy Metabolism; Carbon fixation

Comment:
Thie protein is identical to GenBank accession AAC67987. The aspartate aminotransferase catalyzes the interconversion of aspartate and glutamate. In other bacteria, it is a homodimer.

From Prosite PDOC00098:

Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue.

Aspartate aminotransferase (AAT) (EC 2.6.1.1). AAT catalyzes the reversible transfer of the amino group from L-aspartate to 2-oxoglutarate to form oxaloacetate and L-glutamate. In eukaryotes, there are two AAT isozymes: one is located in the mitochondrial matrix, the second is cytoplasmic. In prokaryotes, only one form of AAT is found (gene aspC).


Blast Summary:  PSI-Blast Search
CT390 is orthologously related to CPn0495: residues 1-392 are 56% similar to residues 1-385 of CPn0495. Numerous hits in gapped BLAST to aspartate aminotransferase sequences, e.g., residues 10-392 are 36% similar to the enzyme from M. thermoautotrophicum (AE000797). CT390 is weakly similar to a predicted hemolysin from T. denticola (U30249). No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0436
COG name: PLP-dependent aminotransferases
Functional Class:  E
The phylogenetic pattern of COG0436 is AMTKYQVCEBRhUJ---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 173-183, 206-217, and 239-252 are significantly matched
to blocks BL00105D,E,F, which contain aminotransferase sequences,
e.g., ATTY_RHIME.

ProDom Summary:  Protein Domain Search
Residues 109-215 are 29% similar to an aminotransferase domain
as represented by AAT2_METJA. Residues 106-160 and 172-211
support this assignment (see AAT_SULSO, YD91_METJA).

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 93 to 396 (E-value = 9.8e-17) place CT390 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

PDB Hit:
None.

Gene Protein Sequence:
MDFRWFMKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTT
QPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGFVD
AKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEII
ALPCLQENAFFPEFPEDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIE
HEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIR
LGWTVIPQELTYADGHFVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ
LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQANISDRDLFD
FFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQS


Gene Nucleotide Sequence:  Sequence Viewer
ATGGACTTTAGGTGGTTTATGAAAAGAAACCCTCACTTCGTATCATTAAC
AAAAAATTATTTATTCGCAGATTTACAGAAGAGAGTTGCCCAATTTCGTT
TAGAAAATCCCCAACATACAGTTATTAATTTATCTATTGGAGATACCACC
CAACCACTAAATGCTAGTGTCGCTGAGGCTTTTGCCAGCTCTATTGCCCG
TTTGAGCTCTCCTACAACCTGTCGCGGATATGGACCAGACTTTGGACTAC
CTGCATTAAGACAAAAATTATCGGAAGATTTCTATCGCGGCTTTGTTGAT
GCAAAAGAAATTTTCATTTCGGATGGAGCAAAAGTAGATCTCTTCCGTTT
ACTATCCTTTTTTGGTCCCAATCAAACAGTGGCTATTCAGGATCCTTCTT
ATCCTGCATATCTCGATATCGCTCGCTTAACAGGGGCAAAGGAAATTATC
GCTCTCCCTTGCTTGCAAGAAAATGCATTCTTCCCAGAATTTCCAGAGGA
CACTCACATCGATATTTTATGTCTATGTTCTCCTAATAACCCAACAGGGA
CTGTTTTAAATAAAGACCAACTACGTGCGATCGTTCATTATGCAATAGAA
CACGAGATTCTCATTTTATTTGATGCAGCTTATAGCACCTTCATTTCCGA
TCCTTCTCTCCCTAAAAGTATATTTGAAATTCCTGATGCACGGTTTTGTG
CAATAGAAATCAATTCGTTCTCCAAACCTCTAGGATTTGCAGGCATTCGT
TTAGGTTGGACCGTCATCCCTCAAGAATTGACTTATGCAGACGGCCATTT
TGTGATTCAAGACTGGGAACGCTTCCTTTCAACCACTTTTAATGGGGCTT
CTATCCCCGCTCAAGAAGCTGGCGTTGCAGGATTGTCCATTCTCCCTCAA
CTTGAAGCGATCCACTATTATCGAGAAAATAGCGACCTACTCAGAAAAGC
GCTATTGGCAACTGGATTTGAAGTATTCGGTGGGGAACACGCCCCTTATC
TATGGGTCAAACCCACTCAAGCGAACATCTCTGATAGAGATCTTTTTGAC
TTTTTCTTACGAGAGTACCATATCGCAATTACGCCCGGAATTGGATTTGG
CCGTAGTGGTTCGGGATTTGTACGCTTCTCTTCCTTAGGGAAACGTGAAG
ACATATTAGCAGCCTGCGAACGTTTACAAATGGCTCCTGCTCTGCAATCA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy