Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR315 IGR319 IGR320 IGR316 IGR317 IGR314 IGR321 CT382.1 hitA,ycfF, - CT385 artJ, - CT381 phnP, - CT380 aroG, - CT382 CT386 hflX, - CT379 pgi, - CT378 CT384 CT383 CT387 CT382.1 hitA,ycfF, - CT385 artJ, - CT381 phnP, - CT380 aroG, - CT382 CT386 hflX, - CT379 pgi, - CT378 CT384 CT383 CT387 CT382.1 hitA,ycfF, - CT385 artJ, - CT381 phnP, - CT380 aroG, - CT382 CT386 hflX, - CT379 pgi, - CT378 CT384 CT383 CT387
* Calculated from Protein Sequence

Gene ID: CT382

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroG  

Definition:
phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase)

Gene Start:
436161

Gene Stop:
435328

Gene Length:
834

Molecular Weight*:
30447

pI*:
6.75

Net Charge*:
-1.86

EC:
4.1.2.15  

Functional Class:
amino acid biosynthesis; aromatic  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
This protein has only the DAHP synthase domain and does not have the chorismate mutase domain that can be found in the bifunctional AROG_BACSU protein of Bacillus subtilis or the bifunctional Staphylococcus xylosus chorismate mutase protein. Otherwise, a high similiarity with these two bifunctional proteins and several other bacterial DAHP synthases was observed.
See CPn0484.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to phospho-2-dehydro-3-deoxyheptonate aldolase sequences, e.g., residues
40-273 are 45% similar to DAHP synthase domain of biofunctional AROG_BACSU.
Residues 74-310 are 25% similar to Z50747, a chlamydial 3-deoxy-D-manno-
octulosonic acid aldolase and residues 96-300 are 25% similar
to U72493, a related trachomatis protein that is the ortholog
of CT655. No similarities to T.pallidum or M.genitalium. CT382
is orthologous to CPn0484: residues 7-268 are 66% similar to CPn0484.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0722
COG name: DAHP synthase/3-Deoxy-D-manno-octulosonic acid (KDO) 8-phosphate synthase
Functional Class:  E,M
The phylogenetic pattern of COG0722 is ----YqvcEb-Huj----INx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 101-268 are 48% similar to residues 169-351 of AROG_BACSU.
Residues 40-79 are 42% similiar to residues 88-168 of AROG_BACSU.


Paralogs:  Local Blast Search
CT382 is weakly paralogous to CT655, thought to be
2-dehydro-3-deoxyphosphooctonate aldolase (KDOP synthase): residues 96-300
are 25% similar to CT655.

Pfam Summary:  Pfam Search
Residues 19 to 273 (E-value = 5.1e-121) place CT382 in the DAHP_synth_1 family which is described as DAHP synthetase I family (PF00793)

PDB Hit:
none

Gene Protein Sequence:
MGKKRVPLPHVFNSNRSPVIRLSETVSIGGGTPIIIAGPCTLESQEHAIT
LGLQVKSAGAHIFRGSIRKPRTNPHSFQGWPPDHVVWHSRAKAVHGLLTE
TEVLDVRDVEITAEHVDLLRVGARNMQNFVLLDEVGQSHRPVILKRNPSA
TISEWLSAAEYLLQHASCPGVILCERGIRTFETTTRYTLDLNTVAWIKKE
TSLPVIVDPSHASGRRDLVLPLARAAIALGADGLMIEVHEHPELALCDGS
QHILPCELEELGLWVQEVGSLETGAVFV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAAAAAAACGGGTCCCGCTACCTCATGTATTTAATTCGAATAGGAG
TCCCGTTATTCGTTTATCCGAAACCGTGTCTATAGGTGGAGGGACTCCTA
TCATTATTGCTGGTCCATGTACCTTGGAAAGCCAAGAACATGCAATTACT
TTAGGGCTACAGGTTAAAAGTGCTGGAGCGCATATTTTTCGAGGGTCTAT
TCGTAAGCCAAGAACGAACCCGCATTCTTTTCAAGGTTGGCCTCCCGATC
ACGTAGTGTGGCATAGCCGAGCAAAAGCTGTTCATGGATTATTGACGGAG
ACAGAAGTTTTAGATGTTCGTGATGTGGAAATTACAGCAGAGCATGTAGA
TCTTTTACGAGTGGGGGCTCGCAATATGCAAAATTTTGTCTTGCTAGATG
AAGTAGGACAAAGTCATCGTCCGGTTATTTTAAAAAGAAATCCTTCAGCT
ACAATTTCAGAATGGTTGTCTGCTGCAGAATATTTGTTACAGCATGCTAG
TTGTCCTGGAGTTATTCTTTGTGAGAGAGGGATTCGTACTTTTGAAACAA
CTACTCGATATACATTGGATCTGAATACTGTCGCATGGATTAAGAAGGAA
ACTTCTTTACCTGTGATCGTGGATCCTTCTCACGCATCAGGAAGACGAGA
TTTAGTGTTACCATTAGCTCGTGCTGCAATAGCTTTAGGAGCAGATGGAC
TGATGATTGAAGTCCATGAGCATCCTGAACTAGCTTTATGTGATGGATCA
CAACATATTCTTCCTTGTGAACTCGAAGAGTTAGGGCTTTGGGTTCAAGA
GGTTGGCTCCTTAGAAACAGGAGCAGTTTTTGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy