Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR315 IGR309 IGR316 IGR311 IGR317 IGR314 IGR313 IGR310 IGR312 CT377 CT382.1 artJ, - CT381 phnP, - CT380 aroG, - CT382 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT375 arcD, - CT374 CT377 CT382.1 artJ, - CT381 phnP, - CT380 aroG, - CT382 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT375 arcD, - CT374 CT377 artJ, - CT381 phnP, - CT380 aroG, - CT382 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT382.1 CT373 CT375 arcD, - CT374
* Calculated from Protein Sequence

Gene ID: CT378

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgi  

Definition:
glucose-6-phosphate isomerase

Gene Start:
432185

Gene Stop:
430611

Gene Length:
1575

Molecular Weight*:
57761

pI*:
5.70

Net Charge*:
-9.49

EC:
5.3.1.9  

Functional Class:
energy metabolism; glycolysis and gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pentose phosphate cycle
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
The gene protein sequence of CT378 is identical to accession AAC67974.
See Stephens, R.S., et al., 1998. Science 282: 754-759.

This enzyme interconverts glucose-6-phosphate and fructose-6-phosphate
during glycolysis and gluconeogenesis. In E.coli it is a homodimer.
See CT080.

From Prosite PDOC00157:

Phosphoglucose isomerase (EC 5.3.1.9) (PGI) is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. PGI is involved in different pathways: in most higher organisms it is involved in glycolysis; in mammals it is involved in gluconeogenesis; in plants in carbohydrate biosynthesis; in some bacteria it provides a gateway for fructose into the Entner-Doudouroff pathway. PGI has been shown to be identical to neuroleukin, a neurotrophic factor which supports the survival of various types of neurons.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glucose-6-phosphate isomerase sequences,
e.g., residues 14-521 are 32% similar to G6PI_ECOLI. CT378 is similar to TP0475 of T. pallidum,
a predicted glucose-6-phosphate isomerase. It is also similar to MG111
of M. genitalium and MP0582 of M. pneumoniae.

CT378 is orthologously related to CPn1025:
residues 1-523 are 61% similar to that of CPn1025.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0166
COG name: Glucose-6-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0166 is -m--yqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 84-104, 124-157, 178-220, 244-270, 311-353, 364-387, 414-441,
461-493 are significantly matched to blocks BL00765A,B,C,D,E,F,G,H, which
encompass phosphoglucose isomerase sequences, e.g., G6PI_TRYBB, G6PI_PLAFA,
G6P2_CLACO, among others.

ProDom Summary:  Protein Domain Search
Residues 34-493 are 36% similar to a glucose-6-phosphate isomerase domain
as represented by G6PI_MAIZE.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 50 to 519 (E-value = 5.9e-117) place CT378 in the PGI family which is described as Phosphoglucose isomerase (PF00342)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
403  
466

PDB Hit:
None.

Gene Protein Sequence:
MMGKGFLDCESLVALQEMALHPIDLTASGCLSEERIQKNSLSAEGFTYSY
ATERVDDRCLEALQGLTEERELIKQMECMQQGAIMNRIEGFQSESRPVLH
TATRAWVRDQDLHEEAAAIARHSKEEALRLAEFLYIARAKFSTLVQMGIG
GSELGPKAMYFAMQGSCPSDKRIFFVSNIDPDNAAEVLREIDLEQTLVVV
VSKSGTTLEPAANEELFRQAYQNKGLSIAEHFVAVTSQGSPMDDKSRYLE
VFHLWDSIGGRFSATSMVGGVVLGFAFGYEAFIEFLQGAAAIDAHALTPK
MRENLPLLSAMLGVWNRNLLGYPTTAVIPYSTGLKYFTAHLQQCGMESNG
KSISREGKEISFRTSPIIWGDVGTNCQHSFFQSLHQGTDIVPVEFIGFLH
NQRGLDCVLSGSSSSQKLFANLVAQSLALAQGRDNANSNKRFKGNRPSSI
LVAQQLSPRIAGSLLAFYEHKFAFQGFCWGINSFDQEGVSLGKELATQII
GIMSGNAPVEFSEARGMLRLFNVLT

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGGGTAAAGGTTTTTTAGATTGTGAGTCATTAGTTGCTTTGCAAGA
GATGGCTTTGCATCCGATTGATTTGACTGCATCAGGATGCTTATCTGAAG
AGCGTATTCAGAAAAACTCTTTATCTGCAGAAGGATTTACCTATAGTTAT
GCTACGGAACGTGTAGATGATCGCTGCTTAGAGGCTTTACAAGGACTTAC
TGAAGAGAGGGAATTGATCAAACAGATGGAGTGTATGCAACAAGGCGCCA
TCATGAATCGTATAGAAGGTTTTCAGAGCGAATCTCGCCCTGTATTGCAT
ACGGCAACACGCGCTTGGGTTCGAGATCAAGATCTTCATGAAGAAGCTGC
TGCGATAGCAAGACACTCTAAGGAGGAAGCTCTTCGTCTTGCAGAGTTTC
TGTATATAGCTCGTGCTAAATTTTCTACGCTTGTACAGATGGGTATTGGG
GGCTCGGAGTTGGGCCCTAAAGCTATGTATTTTGCTATGCAAGGCTCTTG
CCCATCTGATAAGAGAATCTTTTTTGTCTCCAATATTGATCCGGATAATG
CTGCAGAAGTATTACGGGAGATAGATTTGGAGCAAACACTGGTTGTTGTG
GTTTCTAAGTCAGGAACAACTTTAGAGCCTGCAGCAAATGAAGAGCTGTT
CAGACAGGCTTATCAAAATAAAGGTTTATCTATTGCAGAGCATTTTGTAG
CGGTAACTTCTCAAGGCAGCCCTATGGATGATAAGAGTCGTTATCTAGAA
GTATTCCATCTTTGGGATAGTATTGGCGGAAGATTTTCAGCTACATCCAT
GGTAGGAGGAGTTGTATTAGGTTTTGCTTTCGGTTACGAAGCTTTTATAG
AGTTTTTGCAAGGAGCAGCTGCTATCGATGCTCATGCGCTGACTCCAAAA
ATGAGAGAGAATCTTCCTCTTCTATCTGCGATGCTTGGAGTTTGGAATCG
TAATCTGTTAGGGTATCCTACAACAGCAGTGATTCCTTATTCGACAGGAT
TGAAATATTTTACAGCGCATTTACAACAGTGTGGAATGGAATCCAATGGA
AAAAGTATTTCGAGAGAAGGGAAGGAGATTAGTTTTAGGACTTCACCCAT
TATTTGGGGCGATGTGGGGACAAACTGTCAGCATTCTTTTTTCCAAAGTC
TTCATCAAGGAACAGATATTGTTCCCGTAGAGTTCATTGGATTTTTGCAT
AACCAACGAGGGCTAGATTGTGTATTATCAGGAAGCTCATCATCTCAAAA
GCTCTTTGCAAACCTTGTTGCTCAATCTTTAGCTTTAGCTCAGGGTAGAG
ATAATGCGAACTCGAATAAGAGGTTTAAAGGGAACAGACCTTCTTCGATA
TTGGTAGCGCAACAGCTTTCTCCTCGTATTGCTGGTAGTTTATTGGCTTT
TTATGAGCATAAATTTGCATTTCAAGGGTTTTGCTGGGGAATCAATTCTT
TTGACCAAGAAGGGGTTTCATTAGGGAAAGAATTGGCAACGCAAATTATA
GGCATCATGTCGGGGAATGCTCCTGTAGAGTTTTCCGAAGCTCGAGGTAT
GTTAAGACTTTTTAACGTTTTAACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy