Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR315 IGR309 IGR316 IGR311 IGR308 IGR314 IGR313 IGR310 IGR312 CT377 artJ, - CT381 phnP, - CT380 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT375 CT372 arcD, - CT374 CT377 artJ, - CT381 phnP, - CT380 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT375 CT372 arcD, - CT374 CT377 artJ, - CT381 phnP, - CT380 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT375 CT372 arcD, - CT374
* Calculated from Protein Sequence

Gene ID: CT376

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mdhC  

Definition:
malate dehydrogenase

Gene Start:
430162

Gene Stop:
429185

Gene Length:
978

Molecular Weight*:
35695

pI*:
6.71

Net Charge*:
-1.25

EC:
1.1.1.82  

Functional Class:
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)
Carbohydrate Metabolism; Glyoxylate and dicarboxylate metabolism
Carbohydrate Metabolism; Pyruvate metabolism
Energy Metabolism; Carbon fixation

Comment:
Malate dehydrogenase is an important enzyme in chloroplasts. Malate
is converted to oxaloacetate in the course of the photosynthesis C4 cycle.
Cytoplasmic forms are encountered in eukaryotes and the enzyme is found
in other bacteria (e.g., mycobacterium).

Best hits are to NADP-dependent plant sequences (EC = 1.1.1.82); alternatively
this may be a NAD-dependent enzyme (EC = 1.1.1.37).

CT376 was assigned the EC number 1.1.1.82 in our original annotation. Comparison of the annotation in the STD genome database with the annotation done by KEGGs leads us to re-examine this protein.

The top hits in Gaped-BLAST were to NADP-malate dehydrogenase which are assigned the EC number 1.1.1.82 in the Swiss-Prot and Pir databases.

Several hits to NAD-malate dehydrogenase were observed at lower significance levels. The EC number assigned to these proteins by Swiss-Prot and Pir are 1.1.1.37.

The clustalw guide tree and the Phylogenetic analysis did not clearly indicate which group CT376 belongs to. However, two archaebacterial malate dehydrogenase were assigned two EC numbers, 1.1.1.82 and 1.1.1.37.

The difference in annotation between the STD database and the KEGG database for CT376 will remain unresolved until further data is available.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to NADP-malate dehydrogenase sequences, e.g.
residues 6-325 are 43% similar to MDHC_FLABI. A preponderance of similarities to
chloroplast enzymes. Residues 1-324 are 41% similar to MDH_MYCLE. No similarities to T.pallidum or
M.genitalium.

CT376 is orthologously related to CPn1028:
residues 4-325 are 82% similar to residues
5-326 of CPn1028.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0039
COG name: Malate/lactate dehydrogenases
Functional Class:  C
The phylogenetic pattern of COG0039 is amt-YQvceBrh--gpo-inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 8-25, 28-41, 83-110, 127-173, 267-284 are similar to blocks BL00068A-D,
concerned with malate dehydrogenase sequences, e.g. MDH_MYCLE, MDHC_FLABI.

ProDom Summary:  Protein Domain Search
Residues 46-317 are 44% similar to a malate dehydrogenase domain as seen in
MDHC_FLABI. Residues 3-34 and 259-324 are consistent with this finding
(see MDH_THEFL, MDHC_HUMAN).

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 155 (E-value = 9.3e-35) place CT376 in the Ldh_1_N family which is described as lactate/malate dehydrogenase, NAD binding domain (PF00056)
Residues 158 to 326 (E-value = 1.6e-18) place CT376 in the Ldh_1_C family which is described as lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
221  
269

PDB Hit:
gi|576009|pdb|1BMD|A Chain A, Malate Dehydrogenase (E.C.1.1.1.37) (Bacterial) Complexed With Nadh

Gene Protein Sequence:
MVSQTVSVAVTGGTGQIAYSFLFSLAHGDVFGLDCGIDLRIYDIPGTERA
LSGVRMELDDGAFPLLQRVQVTTSLHDAFDGIDAAFLIGSVPRGPGMERR
DLLKKNGEIFATQGKALNTTAKRDAKIFVVGNPVNTNCWIAMNHAPRLLR
KNFHAMLRLDQNRMHSMLSHRAEVPLSAVSQVVVWGNHSAKQVPDFTQAL
INDRPIAETIADRDWLENIMVPSVQSRGSAVIEARGKSSAASAARALAEA
ARSIYQPKEGEWFSSGVCSDHNPYGLPEDLIFGFPCRMLATGEYEVIPRL
PWDAFIRGKMQISLDEILQEKASVSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTCTCAAACAGTGAGTGTAGCAGTAACAGGAGGAACAGGGCAAAT
AGCCTATAGCTTTCTATTTTCTCTGGCTCATGGAGATGTTTTTGGCCTTG
ATTGTGGCATCGATCTGCGTATCTACGATATTCCTGGAACAGAAAGGGCT
TTATCTGGTGTGCGCATGGAGCTAGATGATGGTGCTTTCCCTTTATTACA
GCGTGTGCAGGTAACGACATCATTGCATGATGCTTTTGATGGCATTGATG
CGGCATTCCTTATAGGGTCAGTTCCTAGAGGCCCAGGAATGGAGAGAAGA
GATCTTCTAAAGAAAAATGGGGAGATTTTTGCTACGCAAGGAAAAGCTTT
GAACACAACAGCCAAGCGGGATGCAAAGATTTTTGTTGTTGGGAACCCTG
TGAATACCAATTGCTGGATAGCAATGAATCATGCTCCCAGATTATTGAGA
AAGAACTTTCATGCGATGCTACGATTGGACCAGAATCGTATGCATAGCAT
GTTATCGCATAGAGCAGAAGTACCTTTATCGGCTGTATCACAAGTTGTGG
TTTGGGGAAATCACTCCGCCAAACAAGTGCCTGATTTTACGCAAGCTCTG
ATTAATGACCGTCCTATCGCAGAGACGATAGCGGATCGTGATTGGTTAGA
GAATATTATGGTGCCTTCTGTACAGAGTCGTGGTAGTGCAGTAATCGAAG
CACGAGGGAAGTCTTCGGCAGCTTCTGCAGCACGAGCTTTAGCAGAGGCT
GCTCGATCAATATATCAGCCAAAAGAAGGAGAATGGTTTTCTTCCGGAGT
GTGTTCGGACCACAATCCCTATGGATTACCGGAAGATTTAATCTTTGGTT
TCCCTTGTCGAATGCTAGCAACGGGAGAATATGAAGTGATTCCAAGGCTT
CCTTGGGATGCCTTTATCCGTGGGAAAATGCAAATATCTCTTGATGAGAT
TCTTCAGGAAAAAGCTAGCGTATCTTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy