Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR309 IGR311 IGR308 IGR314 IGR313 IGR307 IGR310 IGR312 CT377 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT371 CT375 CT372 arcD, - CT374 CT377 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT371 CT375 CT372 arcD, - CT374 CT377 mdhC, - CT376 hflX, - CT379 pgi, - CT378 CT373 CT371 CT375 CT372 arcD, - CT374
* Calculated from Protein Sequence

Gene ID: CT375

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical; probable D-amino acid dehydrogenase

Gene Start:
428082

Gene Stop:
429137

Gene Length:
1056

Molecular Weight*:
38024

pI*:
5.38

Net Charge*:
-8.73

EC:
1.4.3.3  

Functional Class:
uncategorized  

Pathway: pathway table
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Glycine, serine and threonine metabolism

Comment:
This enzyme reported for H.pylori as well as Synechocystis.

From Prosite PDOC00573:

D-amino acid oxidase (EC 1.4.3.3) (DAMOX or DAO) is an FAD flavoenzyme that catalyzes the oxidation of neutral and basic D-amino acids into their corresponding keto acids. DAOs have been characterized and sequenced in fungi and vertebrates where they are known to be
located in the peroxisomes.

Blast Summary:  PSI-Blast Search
Four hits in gapped BLAST to D-amino acid dehydrogenase sequences,
e.g., residues 117-300 are 27% similar to a Synechocystis protein U38892.
(ThiG). Residues 183-308 are 28% similar to a D-amino acid dehydrogenase from
P.aeroginosa (L48934). No similarities to T.pallidum or M.genitalium.

CT375 is orthologously related to CPn1030: residues 1-347 of CT375 are 71%
similar to residues 1-347 of CPn1030, a predicted D-amino acid dehydrogenase
from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0665
COG name: Predicted oxidoreductases
Functional Class:  R
The phylogenetic pattern of COG0665 is amtKyq-CEBRhuj--o-in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 2-24 and 3-17 are matched to blocks PR00419A,D, concerned with adrenodoxin reductase sequences, e.g., ADRO_HUMAN. Residues 66-77 are related to block BL01054A, which encompasses transaldolase sequences, e.g., TAL_SYNY3. Residues 2-17 and 33-48 are matched to block PR00370A, which includes flavin-containing monooxidase sequences, e.g., FMO4_HUMAN.
CT375 is orthologously related to CPn1030: residues 1-347 are 71% similar to CPn1030.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis, however residues 2-19 are 50% identical
to a stretch of CT745, thought to be a protoporphyrinogen oxidase.

Pfam Summary:  Pfam Search
Residues 1 to 337 (E-value = 3.6e-51) place CT375 in the DAO family which is described as FAD dependent oxidoreductase (PF01266)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
99

PDB Hit:
None.

Gene Protein Sequence:
MHIAVLGAGYAGLSVTWHLLLYTQGRISVDLFDPTPIGSGASGLSSGLLH
GFTGKKAIKPPLANLGITTTHSLITKASLSIGEPIVTSNGILRPAASQEQ
ATIFMQRAQEFPDETEWWDKARCEITVPGMVIADGLGALYIKHGVTIDND
KYISGLWNACASLGTQYYDELIDDISAIAEFYDHIIVTPGANADILPELK
HLPLSKVKGQLVEIAWPAEIPMPPFSINGPKYMVADTTRNTCILGATFEH
NQPDATPDAQVAYQEIMPPILALFPGLKDAQVLNYYAGMRSSSPTHLPMI
SRVQEKLWYLGGLGSKGLLYHGLLGDMLAQALLRDSTAYIAKEFLYTPEG
AA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACATAGCGGTTTTGGGAGCGGGATACGCAGGATTATCTGTGACTTG
GCATCTTCTCCTTTATACACAAGGACGAATTAGCGTTGATCTCTTTGACC
CAACCCCTATTGGATCTGGAGCCTCAGGCCTATCTTCTGGCCTTCTTCAT
GGCTTTACAGGGAAAAAAGCTATCAAGCCTCCGCTAGCAAATCTAGGGAT
CACCACAACCCATTCTCTCATTACCAAAGCGAGCCTTTCTATAGGGGAGC
CCATCGTGACATCCAATGGGATCCTCCGTCCTGCAGCCTCTCAGGAACAG
GCCACTATTTTCATGCAAAGAGCACAGGAGTTCCCCGATGAAACGGAGTG
GTGGGATAAAGCTCGGTGTGAAATTACAGTTCCTGGAATGGTCATTGCCG
ATGGACTCGGAGCCCTTTACATTAAACATGGGGTAACCATTGATAATGAT
AAATATATCAGCGGTTTATGGAATGCCTGTGCTAGCCTTGGAACACAATA
TTACGATGAGCTGATCGATGACATTTCAGCAATCGCTGAGTTTTATGATC
ACATTATTGTAACTCCTGGAGCGAACGCAGATATTCTCCCTGAGCTTAAA
CACCTTCCCCTATCTAAAGTAAAAGGTCAGCTCGTAGAAATTGCTTGGCC
AGCTGAGATCCCTATGCCACCATTCAGCATCAATGGCCCTAAATATATGG
TTGCTGATACAACAAGAAATACTTGTATATTGGGAGCAACTTTCGAGCAC
AACCAACCAGATGCCACTCCAGATGCTCAAGTTGCCTATCAGGAAATCAT
GCCTCCGATCCTAGCTCTTTTCCCTGGACTTAAAGACGCTCAAGTCCTTA
ATTATTACGCTGGTATGCGCTCATCGAGCCCCACTCATTTACCCATGATC
AGTCGCGTACAAGAAAAATTGTGGTATTTAGGAGGTTTGGGATCCAAAGG
TCTTCTATACCATGGGCTTTTAGGAGATATGCTCGCCCAGGCTCTATTAC
GGGATTCCACGGCATATATAGCTAAGGAGTTTCTCTACACTCCAGAGGGA
GCAGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy