Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR306 IGR307 IGR305 IGR304 dapB, - CT364 CT365 CT371 aroC, - CT368 aroA, - CT366 CT372 aroE,aroD, - CT370 dapB, - CT364 CT365 CT371 aroC, - CT368 aroA, - CT366 CT372 aroE,aroD, - CT370 dapB, - CT364 CT365 CT371 aroC, - CT368 aroA, - CT366 CT372 aroE,aroD, - CT370 aroL, - CT367 aroB, - CT369 aroL, - CT367 aroB, - CT369
* Calculated from Protein Sequence

Gene ID: CT368

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroC  

Definition:
chorismate synthase

Gene Start:
419882

Gene Stop:
420952

Gene Length:
1071

Molecular Weight*:
38009

pI*:
7.16

Net Charge*:
0.65

EC:
4.6.1.4  

Functional Class:
amino acid biosynthesis; aromatic  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
This enzyme converts 5-O-(1-carboxyvinyl)-3-phosphoshikimate to chorismate and orthophosphate. In other bacteria, it is a homotetramer.

From Prosite PDOC00628:

Chorismate synthase (EC 4.6.1.4) catalyzes the last of the seven steps in the shikimate pathway which is used in prokaryotes, fungi and plants for the biosynthesis of aromatic amino acids. It catalyzes the 1,4-trans elimination of the phosphate group from 5-enolpyruvylshikimate-3-phosphate (EPSP) to form chorismate which can then be used in phenylalanine, tyrosine or tryptophan biosynthesis. Chorismate synthase requires the presence of a reduced flavin mononucleotide (FMNH2 or FADH2) for its activity.

This enzyme is part of the shikimate pathway, CT366-CT370.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to chorismate synthase sequences, e.g.
residues 1-340 are 47% similar to AROC_SYNY3. Residues 3-340 are 45%
similar to AROC_HAEIN. No similarities to T.pallidum or M.genitalium.

CT368 is orthologously related to CPn1037: residues 1-357 are 62%
similar to CPn1037.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0082
COG name: Chorismate synthase
Functional Class:  E
The phylogenetic pattern of COG0082 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 9-59, 59-93, 62-112, 63-91, 101-129, 212-262, 273-301, 322-350
are similar to blocks BL00787A-F, which encompass chorismate synthase sequences,
e.g. AROC_ECOLI, AROC_METJA.

ProDom Summary:  Protein Domain Search
Residues 3-340 are 48% similar to a chorismate synthase domain as observed
in AROC_SYNY3.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 9 to 353 (E-value = 2.9e-125) place CT368 in the Chorismate_synt family which is described as Chorismate synthase (PF01264)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
222  
241

PDB Hit:
none

Gene Protein Sequence:
MHNQYGSIFSITTWGESHGPAIGVVIDGCPAGLSLSPEDFLPAMARRRPG
QLHTSPRQEPDLVTILSGVYQNKTTGTPISLLIENKDVSSSSYEQLQHCY
RPGHAQFAYEGKYGFADNRGGGRASARETASRVAAGVIAKKILLSQRIET
LAFLSGFGTLESKNYPKLSDSLIQQVHTSPFYTLLPQEEIQNLLLLNPDD
SFGGVVSFITSPLPIGLGEPVFGKLPALLAAAMMSIPAAKGFEIGAGFSS
SQMTGSAYLDAFIADESGVSLQSNRCGGALGGISIGQPLEGRVAFKPTSS
IKKPCSSVLKDGTLIAYRTPNQGRHDPCVAIRAVAVVEAMLDLTLVDLLL
QHRCTQL

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATAATCAATATGGCTCCATATTCTCTATCACTACTTGGGGAGAATC
CCATGGCCCTGCTATAGGCGTCGTAATTGATGGGTGTCCTGCAGGTCTCT
CCTTATCACCAGAAGATTTTCTTCCCGCTATGGCTAGAAGGAGACCAGGG
CAACTTCATACTTCTCCTCGTCAAGAACCGGACCTAGTCACTATTTTATC
TGGAGTCTACCAAAACAAAACAACAGGAACTCCAATCTCTCTTCTTATTG
AAAACAAGGATGTATCCAGCTCTTCTTATGAACAGCTACAACACTGTTAC
CGACCGGGGCACGCACAATTTGCCTATGAAGGGAAATACGGATTTGCAGA
CAACCGTGGAGGAGGACGCGCCTCTGCTAGAGAGACCGCGTCTCGAGTTG
CTGCTGGTGTGATTGCTAAAAAGATCCTTTTATCTCAAAGAATCGAAACA
CTCGCATTCCTTTCTGGATTCGGCACCTTAGAGAGTAAAAATTATCCCAA
ACTTTCCGACTCGCTAATACAACAGGTTCATACCTCTCCTTTCTACACAC
TCCTTCCTCAAGAAGAAATTCAGAATCTCCTTCTGCTTAATCCTGACGAC
TCTTTTGGAGGTGTAGTCTCTTTTATCACTTCTCCTTTACCTATAGGCCT
AGGCGAACCTGTGTTTGGAAAGCTTCCAGCTCTTTTAGCTGCAGCCATGA
TGAGCATCCCTGCGGCTAAAGGATTTGAAATAGGAGCCGGTTTCTCTTCA
TCACAAATGACAGGCTCCGCCTATCTAGATGCATTTATTGCTGATGAAAG
TGGGGTGTCTCTTCAAAGCAATCGCTGTGGAGGAGCTTTAGGGGGGATTA
GTATTGGGCAGCCTCTTGAAGGCCGTGTAGCCTTCAAACCCACTTCATCT
ATAAAAAAACCTTGCTCCTCCGTTTTAAAAGATGGCACACTGATCGCATA
CCGCACCCCTAATCAAGGACGCCACGATCCTTGTGTAGCCATTCGAGCTG
TTGCCGTTGTTGAGGCTATGCTTGATTTAACTCTAGTAGACCTGCTTCTC
CAACATCGTTGTACCCAATTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy