Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR303 IGR306 IGR307 IGR305 IGR304 dapB, - CT364 asd, - CT363 CT365 CT371 aroC, - CT368 aroA, - CT366 CT372 aroE,aroD, - CT370 dapB, - CT364 asd, - CT363 CT365 CT371 aroC, - CT368 aroA, - CT366 CT372 aroE,aroD, - CT370 dapB, - CT364 asd, - CT363 CT365 aroC, - CT368 aroA, - CT366 CT372 aroE,aroD, - CT370 aroL, - CT367 aroB, - CT369 aroL, - CT367 aroB, - CT369 CT371
* Calculated from Protein Sequence

Gene ID: CT367

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroL  

Definition:
shikimate kinase

Gene Start:
419335

Gene Stop:
419886

Gene Length:
552

Molecular Weight*:
20497

pI*:
6.76

Net Charge*:
-0.85

EC:
2.7.1.71  

Functional Class:
amino acid biosynthesis; aromatic  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
This enzyme converts shikimate to shikimate-3-phosphate, a necessary step in the shikimate pathway. In E.coli, there are two isozymes, however in C.trachomatis, CT367 appears to be the only enzymatic form.

From Prosite PDOC00868:

Shikimate kinase (EC 2.7.1.71) catalyzes the fifth step in the biosynthesis from chorismate of the aromatic amino acids (the shikimate pathway) in bacteria (gene aroK or aroL), plants and in fungi (where it is part of a multifunctional enzyme which catalyzes five consecutive steps in this pathway).

Shikimate kinase is a small protein of about 200 residues.

This enzyme is part of the shikimate pathway, CT366-CT370.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to shikimate kinase sequences,
e.g., residues 10-145 are 27% similar to AROL_LYCES. No similarities to
T.pallidum or M.genitalium.

CT367 is orthologously related to CPn1038: residues 10-153 are 35% similar to
CPn1038.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0703
COG name: Shikimate kinase
Functional Class:  E
The phylogenetic pattern of COG0703 is ----yqvcEBrhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 10-43 and 59-76 are significantly matched to
shikimate kinase blocks BL01128A,B, which include sequences
ARO1_PNECA, AROL_ERWCH.

ProDom Summary:  Protein Domain Search
Residues 10-67 are 36% similar to a shikimate kinase domain
as represented by AROK_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis. Residues 10-36
are 48% identical to a stretch of CT344, an ATP-dependent
protease. (Does this correspond to an ATP binding region?)

Pfam Summary:  Pfam Search
Residues 8 to 173 (E-value = 1.2e-08) place CT367 in the SKI family which is described as Shikimate kinase (PF01202)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
59  
184

PDB Hit:
none

Gene Protein Sequence:
MPTFDTTKQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHGDS
PKTIYQRYGEEGFCREEFLALTSVPVIPSIVALGGCTPIIEPSYAHILGR
NSALLVLLELPIATLCQRLQHRSIPERLAHAPSLEDTLSQRLDKLRSLTS
NAFSLRAETSSEAVMRDCQSFCLRFLSTKESSYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAACGTTCGACACTACCAAGCAGATTTTCCTTTGCGGTCTTCCTTC
TGTAGGTAAAACCTCGTTTGGTCAACATTTATCGCAATTTCTATCGCTGC
CTTTTTTTGATACAGATCACCTTCTTTCAGATCGTTTCCATGGAGATTCT
CCTAAAACTATCTACCAACGCTATGGAGAAGAAGGTTTTTGCAGAGAAGA
ATTCCTTGCCCTAACTAGTGTACCTGTCATTCCTAGCATCGTAGCTTTAG
GAGGCTGTACCCCTATTATTGAACCATCTTACGCCCATATTTTGGGGAGA
AACAGTGCTCTCTTAGTCTTACTCGAACTCCCCATCGCTACACTATGTCA
ACGCCTACAACATAGATCTATTCCTGAAAGACTTGCACATGCTCCATCAT
TAGAAGATACTTTGTCTCAACGATTAGACAAACTACGATCCCTCACATCA
AATGCCTTCTCTTTACGAGCAGAGACTTCCTCTGAAGCTGTGATGAGAGA
TTGTCAAAGCTTTTGTTTGCGTTTTTTGAGCACAAAAGAGAGCTCCTATG
CA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy