Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR303 IGR306 IGR305 IGR304 dapB, - CT364 lysC, - CT362 CT365 CT371 aroC, - CT368 aroA, - CT366 aroE,aroD, - CT370 dapB, - CT364 lysC, - CT362 CT365 CT371 aroC, - CT368 aroA, - CT366 aroE,aroD, - CT370 dapB, - CT364 lysC, - CT362 CT365 asd, - CT363 asd, - CT363 CT371 aroC, - CT368 aroA, - CT366 aroE,aroD, - CT370 aroL, - CT367 aroB, - CT369 aroL, - CT367 aroB, - CT369
* Calculated from Protein Sequence

Gene ID: CT366

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroA  

Definition:
3-phosphoshikimate-1-carboxyvinyltransferase (EpsP synthase)

Gene Start:
418071

Gene Stop:
419390

Gene Length:
1320

Molecular Weight*:
47775

pI*:
8.13

Net Charge*:
8.39

EC:
2.5.1.19  

Functional Class:
amino acid biosynthesis; aromatic  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
This enzyme is part of the shikimate pathway (CT366-CT370), converting
3-phosphoshikimate to O(5)-(1-carboxyvinyl)-3-phosphoshikimate.

From Prosite PDOC00097:

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (EC 2.5.1.19) catalyzes the sixth step in the biosynthesis from chorismate of the aromatic amino acids (the shikimate pathway) in bacteria (gene aroA), plants and fungi (where it is part of a multifunctional enzyme which catalyzes five consecutive steps in this pathway). EPSP synthase has been extensively studied as it is the target of the potent herbicide glyphosate which inhibits the enzyme.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to EpsP synthase sequences,
e.g., residues 6-422 are 26% similar to AROA_ECOLI. Residues 17-425 are
29% similar to AROA_METJA. No similarities to T.pallidum and M.genitalium.

CT366 is orthologously related to CPn1039: residues 10-440 are 50%
similar to CPn1039.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0128
COG name: 5-enolpyruvylshikimate-3-phosphate synthase
Functional Class:  E
The phylogenetic pattern of COG0128 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 22-46, 90-102, 114-140, 157-181, 234-250, 258-284,
300-324, 321-365, 377-392 are significantly matched to
blocks BL00104A-G, which encompass EPSP synthase sequences,
e.g., AROA_METJA, AROA_LACLA, AROA_SYNY3.

ProDom Summary:  Protein Domain Search
Residues 312-414 are 48% similar to an EPSP synthase domain
of AROA_SYNY3. Residues 11-82, 17-139, 22-190, 195-282,
277-331, 298-335 support this association as exemplified
by similarities to AROA_KLEPN, AROA_METJA, et al.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 11 to 418 (E-value = 3.7e-169) place CT366 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
95  
318

PDB Hit:
gi|442878|pdb|1EPS| 5-Enol-Pyruvyl-3-Phosphate Synthase (E.C.2.5.1.9)

Gene Protein Sequence:
MVSSNQDLLISPSIPYGEIAVPPSKSHSLRAILFASLSKGTSIIENCLFS
PDSQAMLTACEKMGAHVRRIGDSLHIQGNPDPHHCHPRYFHMGNSGIALR
FLTALSTLSPTPTLITGSHTLKRRPIAPLLSSLKQLGAHIRQKTSSSIPF
TIHGPLSPGHVTISGQDSQYASALAITAALAPYPLSFSIENLKERPWFDL
TLDWLHSLNISFLRDQDSLTFPGGQSLESFSYSVPGDYSSAAFLASFGLL
SSSSKPTILRNLSSQDSQGDKLLFSLLKQLGAHILIGKHHIEMHPSSFSG
GEIDMDPFIDALPILAVLCCFAKNPSRLYNALGAKDKESNRIEAIAHELQ
KMGGSVHPTRDGLYIEPSRLHGAVVDSHNDHRIAMALAVAGVHASSGQTL
LCNTQCINKSFPYFVIAAQTLHANVRHYQADFPLRSSFCR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTCTCTTCGAACCAAGACCTTCTTATTTCTCCCTCAATTCCTTATGG
AGAAATTGCTGTTCCTCCGTCAAAATCACATTCTCTACGCGCGATCCTTT
TTGCCTCCTTATCCAAAGGGACCTCTATCATAGAAAACTGTCTCTTCTCT
CCCGATTCCCAAGCTATGCTTACAGCCTGTGAGAAAATGGGAGCTCACGT
TAGAAGAATAGGAGACTCCTTACATATCCAGGGGAATCCCGATCCCCATC
ACTGTCACCCACGCTATTTCCATATGGGGAATTCTGGTATCGCCCTTCGA
TTCCTAACCGCCCTTTCTACTTTATCCCCCACCCCCACTTTGATCACAGG
ATCCCACACACTCAAACGACGTCCTATAGCGCCTCTTCTATCAAGCTTAA
AACAGCTTGGTGCGCACATTCGCCAAAAAACATCTTCTTCTATTCCCTTT
ACCATCCATGGTCCATTATCCCCTGGCCATGTTACTATCTCTGGACAAGA
TTCCCAATACGCATCAGCATTAGCAATCACTGCAGCTTTAGCTCCATATC
CCCTTTCTTTTTCTATCGAAAATCTTAAGGAACGTCCTTGGTTTGATCTG
ACCTTAGATTGGCTACACTCTTTAAACATCTCTTTCTTAAGAGACCAAGA
TTCTTTAACTTTCCCCGGAGGACAATCATTAGAAAGTTTTTCTTATTCTG
TGCCTGGAGACTATAGTTCTGCTGCTTTTTTAGCTTCCTTTGGTCTACTC
TCTTCTTCTTCTAAACCAACTATTCTCCGTAATCTTTCTTCTCAAGATTC
TCAAGGGGACAAGCTTCTCTTCTCTTTGTTAAAACAACTTGGAGCCCATA
TTCTTATTGGAAAACATCATATCGAAATGCACCCCTCTTCTTTCTCCGGA
GGTGAAATTGATATGGATCCATTCATAGATGCATTACCCATCCTTGCTGT
CCTCTGCTGCTTTGCAAAAAATCCATCGCGCTTGTATAATGCGTTGGGAG
CAAAGGACAAAGAAAGCAATCGCATTGAAGCCATTGCCCATGAATTGCAA
AAAATGGGTGGTTCTGTCCACCCTACTCGTGACGGTCTATATATAGAGCC
CTCGCGGTTACATGGTGCGGTTGTTGATTCTCATAATGATCACCGTATTG
CTATGGCTCTCGCTGTAGCTGGAGTTCATGCCTCGTCCGGACAAACCCTC
CTCTGTAACACACAGTGTATAAATAAGAGTTTTCCATATTTCGTGATTGC
AGCGCAGACACTACATGCCAACGTTCGACACTACCAAGCAGATTTTCCTT
TGCGGTCTTCCTTCTGTAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy