Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR303 IGR302 IGR301 IGR305 IGR304 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 aroC, - CT368 aroB, - CT369 aroA, - CT366 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 aroC, - CT368 aroB, - CT369 aroA, - CT366 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 asd, - CT363 asd, - CT363 aroC, - CT368 aroB, - CT369 aroA, - CT366 aroL, - CT367 aroL, - CT367
* Calculated from Protein Sequence

Gene ID: CT365

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)

Gene Start:
417901

Gene Stop:
416177

Gene Length:
1725

Molecular Weight*:
60802

pI*:
10.07

Net Charge*:
9.85

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT365 is similar to CPn0474, a Chlamydia-specific hypothetical protein: residues 2-569 are 40% similar to CPn0474.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 56-69 and 216-229 are matched to block BL00627A, which
consists of GHMP kinase sequences, e.g., KHSE_BRELA.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
45
transmembrane  
57  
76
transmembrane  
80  
98
non-globular  
122  
193
transmembrane  
214  
234
transmembrane  
238  
258
transmembrane  
344  
362
transmembrane  
366  
384
transmembrane  
475  
494
transmembrane  
498  
517

PDB Hit:
none

Gene Protein Sequence:
MVSRVPGSSDPVDVNALSNLSPVQNQNSGVSVSAISLPNETVSKSGKTLK
YSTELIAGIVVLGVALAIVAIALTILAPGVPQSIVLAIAFSGISVGGVTT
LRSLINGIKTVVAPRMTFRQRAKSAALLGAGLTGAGLVLKLGSSYIPGGY
GSALGKFGDISYNRGSGALFAGFAHYLYVRFFQSKKAASGEALTPEEMLI
EGAKIRKLANGLVLLGVGFACLGIALAVVGTLAVTGGAATALIVLAPPLI
SLGISLVISNMLHTTLGQWRAFARAQQDQDLLVDTKLKNISQADFSYRVD
NNIEVVVDPRESNLPSIERLSQGEIDAALSLTKKQQRILILSGLLLLAGV
TCTLLAGFGGLPAVQVLLLFSIGGAVSSSAVPMVVSGMVHVAHQLKARLQ
ISLARRREARLKARMIREMDNRRWGESRVGLLSKKEQEETWKLVGKPVIF
QTEQAIREYVNGATKEERFQSILVATIILLAGLGVLSLTLIPGLAPISGG
ILAIGGALLGISITMYLQRFIQWLYEQLIKLRDYIQNRQSVIVQGASACD
FDAEDIIVDLVAESFEVDGDSFVES

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTCTAGGGTTCCCGGAAGTAGTGATCCTGTTGATGTAAATGCTCT
TAGCAACCTTTCTCCTGTACAAAATCAGAACTCAGGAGTTTCTGTATCAG
CGATTTCTCTCCCTAATGAAACAGTTTCTAAATCAGGGAAAACGCTAAAA
TATTCGACAGAGCTCATTGCAGGTATTGTTGTATTAGGGGTTGCATTAGC
AATTGTGGCTATCGCCCTAACGATACTAGCTCCTGGAGTTCCGCAATCGA
TTGTTTTAGCGATTGCTTTTTCAGGAATTTCTGTCGGTGGAGTTACCACG
TTAAGAAGTCTTATTAATGGAATTAAGACCGTAGTTGCTCCGAGAATGAC
ATTCAGACAGAGGGCAAAGAGCGCAGCTCTCCTTGGTGCAGGATTAACGG
GAGCCGGTCTTGTGCTGAAACTTGGATCTTCTTATATTCCTGGGGGATAT
GGTAGCGCTCTCGGGAAATTTGGGGATATTTCTTATAATAGAGGGAGTGG
AGCTCTTTTTGCAGGGTTCGCTCACTATCTCTATGTGCGCTTTTTCCAGT
CAAAAAAAGCTGCATCGGGTGAAGCTCTTACTCCAGAAGAGATGCTCATA
GAAGGAGCAAAGATACGGAAGCTAGCGAATGGATTAGTTCTATTAGGAGT
TGGTTTTGCGTGTTTAGGGATTGCTTTAGCTGTTGTTGGAACTCTTGCTG
TAACTGGAGGGGCCGCAACAGCTCTTATAGTGTTGGCTCCTCCTTTAATC
AGTTTAGGGATTTCTTTAGTGATCTCGAATATGCTGCACACAACTCTAGG
GCAATGGAGAGCTTTTGCTAGAGCTCAACAAGATCAAGATTTACTTGTTG
ATACTAAACTAAAAAACATTTCTCAAGCAGACTTCAGTTATCGGGTAGAT
AACAATATAGAGGTGGTAGTCGATCCTAGAGAGTCTAATCTTCCTTCTAT
TGAACGTTTGTCTCAAGGAGAAATAGATGCAGCATTATCTTTAACGAAGA
AACAACAGCGGATCCTGATTTTATCAGGATTATTATTGCTAGCAGGGGTT
ACTTGTACTTTATTGGCTGGATTTGGGGGATTGCCTGCTGTACAAGTGTT
GCTTCTATTTTCTATAGGAGGAGCTGTATCATCGTCAGCTGTTCCAATGG
TTGTTTCTGGAATGGTTCATGTCGCTCATCAACTAAAAGCTAGATTACAG
ATTAGTTTAGCTCGTAGAAGAGAAGCTCGTTTAAAAGCGCGCATGATAAG
GGAAATGGATAATAGACGATGGGGTGAAAGCCGTGTAGGCTTGCTTTCCA
AGAAGGAGCAAGAGGAAACTTGGAAGTTAGTTGGGAAACCGGTGATTTTT
CAAACAGAGCAAGCTATTCGTGAGTATGTGAATGGAGCAACTAAGGAAGA
AAGATTCCAATCTATTTTAGTTGCTACCATAATCCTTCTAGCTGGTTTGG
GAGTTCTCTCTTTAACTCTAATTCCTGGATTAGCTCCTATATCTGGAGGT
ATTTTAGCTATAGGAGGAGCCCTTTTAGGAATTAGTATTACCATGTATCT
TCAGCGATTTATTCAGTGGCTGTATGAACAGCTGATTAAACTTCGTGACT
ATATTCAGAACCGACAAAGTGTGATCGTTCAGGGAGCTTCTGCATGTGAT
TTTGATGCAGAAGACATCATAGTTGATCTTGTTGCAGAGTCTTTTGAGGT
CGATGGGGATTCTTTTGTAGAATCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy