Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR303 IGR302 IGR301 IGR305 IGR304 IGR300 bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 aroC, - CT368 aroA, - CT366 bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 aroC, - CT368 aroA, - CT366 bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 asd, - CT363 asd, - CT363 aroC, - CT368 aroA, - CT366 aroL, - CT367 aroL, - CT367
* Calculated from Protein Sequence

Gene ID: CT364

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapB  

Definition:
dihydropicolinate reductase

Gene Start:
415997

Gene Stop:
415239

Gene Length:
759

Molecular Weight*:
27762

pI*:
6.27

Net Charge*:
-2.73

EC:
1.3.1.26  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis

Comment:
This enzyme takes tetrahydrodipicolinate to dihydrodipicolinate as part of the lysine biosynthetic pathway. The protein is a homotetramer for which a 3D structure is available.
See CT361, CT362, CT363, and CT430.

From Prosite PDOC01000:

Dihydrodipicolinate reductase (EC 1.3.1.26) catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate. This enzyme is present in bacteria (gene dapB) and higher plants.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to DAPB sequences, e.g., residues
11-242 are 29% similar to DPAB_ECOLI. No similarities to T.pallidum and
M.genitalium.

CT364 is orthologously related to CPn1047: residues 12-238 are 42%
similar to CPn1047.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0289
COG name: Dihydrodipicolinate reductase
Functional Class:  E
The phylogenetic pattern of COG0289 is amt--qvcebrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 135-164 are matched to the block BL01298, which includes
dihydrodipicolinate reductase sequences, e.g., DAPB_METJA.

ProDom Summary:  Protein Domain Search
Residues 57-163 are 41% similar to a dihydrodipicolinate reductase
domain as seen in DAPB_KLEPN. Residues 179-242 also
match a domain of this protein, as exemplified by DAPB_METJA>

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 10 to 114 (E-value = 5e-33) place CT364 in the DapB_N family which is described as Dihydrodipicolinate reductase, N-terminus (PF01113)
Residues 117 to 244 (E-value = 3.5e-58) place CT364 in the DapB_C family which is described as Dihydrodipicolinate reductase, C-terminus (PF05173)

PDB Hit:
gi|1127156|pdb|1DIH| Mol_id: 1; Molecule: Dihydrodipicolinate Reductase; Chain: Null; Ec: 1.3.1.26; Engineered: Yes

Gene Protein Sequence:
MRVADSIMKKSIGLVGDTGRMGVLLTQALLCRPHCFLGKGFSRRSQTSLE
EVVTENDILVDFSSPEVTSLLLDFLLKTPRPVIIGTTGFTNDSGVKTKLS
ALSEYVPVVVCANTSLGAYVQKRLAAFAAKLFSTSYDVRILETHHRAKAD
AISGTAISLAEAIRSAKAESYEEEPEPFIEMHGSRLGNVCGEHEVSFVGE
DERFVIRHEVFSRRVFSGGVLLILEKIMGEGLPKGYYTSDVLYESLFQEK
VFG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGTTGCTGATAGTATTATGAAAAAAAGCATAGGCCTTGTCGGAGA
TACTGGGAGGATGGGTGTCTTATTGACTCAGGCTTTACTTTGTCGTCCTC
ACTGTTTTTTGGGAAAGGGGTTTTCAAGAAGATCTCAGACCTCGCTAGAA
GAGGTTGTTACAGAGAATGATATTCTTGTTGATTTCTCGTCTCCTGAAGT
GACGTCGCTGCTTTTAGACTTTTTGTTAAAAACACCTAGGCCTGTGATTA
TTGGAACTACAGGATTTACTAATGATAGCGGTGTAAAAACAAAGTTATCA
GCATTATCAGAATATGTTCCTGTTGTTGTTTGTGCAAACACGAGTTTGGG
GGCGTATGTACAAAAGCGATTAGCAGCTTTTGCTGCAAAACTTTTTAGTA
CTTCTTATGATGTTCGTATTTTAGAGACACATCACCGTGCTAAAGCAGAT
GCCATTTCTGGTACAGCGATTTCTTTGGCTGAAGCTATCCGTTCTGCGAA
GGCAGAGAGCTATGAGGAAGAGCCAGAGCCTTTTATCGAAATGCATGGTT
CTCGTTTAGGGAATGTTTGTGGCGAGCATGAAGTATCTTTTGTAGGGGAA
GATGAGCGTTTTGTAATTCGGCACGAAGTCTTTTCTCGACGTGTTTTTTC
TGGTGGAGTGTTGCTAATCTTGGAGAAGATTATGGGAGAAGGCTTGCCAA
AAGGATATTACACCTCAGATGTTTTGTATGAGAGTTTGTTTCAAGAAAAG
GTGTTTGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy