Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR303 IGR302 IGR298 IGR299 IGR301 IGR304 IGR300 IGR297 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 lysC, - CT362 CT365 CT356 asd, - CT363 asd, - CT363 CT358 CT357
* Calculated from Protein Sequence

Gene ID: CT361

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dapA  

Definition:
dihydrodipicolinate synthase

Gene Start:
412924

Gene Stop:
412067

Gene Length:
858

Molecular Weight*:
31277

pI*:
5.47

Net Charge*:
-2.89

EC:
4.2.1.52  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis

Comment:
This enzyme converts aspartate semialdehyde to dihydrodipicolinate (contributing to lysine biosynthesis. The enzyme in BACSU is a homotetramer. See Chen et al., J.Biol.Chem. 268:9448 (1993).

See CT362, CT363, CT364 and CT430.

From Prosite PDOC00569:

Dihydrodipicolinate synthetase (EC 4.2.1.52) (DHDPS) catalyzes, in higher plants chloroplast and in many bacteria (gene dapA), the first reaction specific to the biosynthesis of lysine and of diaminopimelate. DHDPS is responsible for the condensation of aspartate semialdehyde and pyruvate by a ping-pong mechanism in which pyruvate first binds to the enzyme by forming a Schiff-base with a lysine residue.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to dihydrodipicolinate synthase
sequences, e.g., residues 1-274 are 27% similar to the
A.thaliana enzyme (S46304). No similarities to T.pallidum and
M.genitalium.

CT361 is similar to CPn1050, a predicted Dihydrodipicolinate Synthase:
residues 1-259 are 44% similar to CPn1050.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0329
COG name: Dihydrodipicolinate synthetase/N-acetylneuraminate lyase
Functional Class:  E,M
The phylogenetic pattern of COG0329 is amtk-qvcEBrHuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 2-11, 16-68, 17-69, 68-118, 99-121, 125-147, 179-204,
219-244 are significantly matched to blocks BL00665A,B,C,D,E,F,
which encompass dihydrodipicolinate synthase sequences,
e.g. DAPA_BACSU, DAPA_ECOLI, DAPA_METJA.

ProDom Summary:  Protein Domain Search
Residues 34-161 are 27% similar to a dihydrodipicolinate
synthase domain observed in DAPA_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 274 (E-value = 2e-15) place CT361 in the DHDPS family which is described as Dihydrodipicolinate synthetase family (PF00701)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
59  
76

PDB Hit:
gi|1942361|pdb|1DHP|A Chain A, Dihydrodipicolinate Synthase Synthase, Dihydrodipicolinate Mol_id: 1; Molecule: Dihydrodipicolinate Synthase; Chain: A, B; Synonym: Dhdps; Ec: 4.2.1.52; Engineered: Yes; Mutation: A207t

Gene Protein Sequence:
MSVLGACITPFKADLSIDFAALESVVRSQEHAGNGIILFGSTGEGLSLTY
EEKLSILSFVSTLNLNVPIFVGVTATSVQETMSWIDFAQQWPIDGFLVPT
PLYTRPGLNGQKAWFDRILSVSRKPIILYNNPIRTGVSLYPEVVKSFVSH
PLCIGVKDSGGSAQACELFAESGLRVFCGDDNLWPDMRLSGASGVISVLA
NVWPELARDYVAQGRPIEAWKKVCSWLNLSTNPLGIKALMAAQKMIECDA
VRPPLSIRDLQRRDELADILACRATLQTELLSVCRQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGTCTTGGGGGCCTGTATTACACCTTTTAAGGCTGATTTGTCTAT
AGATTTCGCTGCTTTAGAGAGTGTCGTTCGTTCGCAAGAGCACGCCGGTA
ACGGCATTATTTTATTTGGTAGTACAGGAGAGGGGTTGTCTCTAACGTAT
GAAGAGAAGCTTTCTATTCTTTCGTTTGTTTCTACGCTTAACTTGAATGT
GCCGATATTTGTAGGAGTGACGGCAACGTCTGTTCAGGAAACTATGTCTT
GGATTGATTTTGCACAGCAATGGCCTATAGATGGGTTCCTTGTTCCAACT
CCTCTTTATACGAGACCTGGGCTTAATGGACAAAAAGCTTGGTTTGATAG
GATTTTGAGTGTAAGTAGAAAGCCTATCATTCTTTATAACAATCCTATTC
GTACCGGCGTGTCTTTGTATCCAGAGGTCGTGAAATCTTTTGTATCACAT
CCTTTGTGCATAGGAGTTAAGGATTCTGGAGGGTCTGCTCAGGCTTGTGA
GCTTTTTGCTGAGTCAGGATTGAGAGTGTTTTGTGGTGACGACAATCTGT
GGCCAGATATGCGATTATCTGGAGCATCTGGAGTGATTTCTGTACTAGCT
AACGTTTGGCCAGAATTAGCTCGAGATTATGTTGCTCAAGGTCGTCCTAT
TGAAGCTTGGAAGAAAGTTTGTTCTTGGCTCAACTTATCTACGAATCCTT
TAGGGATCAAAGCTCTAATGGCAGCTCAGAAAATGATTGAGTGTGATGCG
GTGCGTCCACCTCTTTCTATACGAGATTTGCAGAGAAGAGATGAGTTAGC
AGACATTCTAGCTTGTAGGGCTACTTTGCAAACAGAGCTTCTTAGCGTAT
GCCGGCAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy