Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR303 IGR302 IGR298 IGR299 IGR301 IGR304 IGR300 IGR296 IGR297 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 CT355 lysC, - CT362 CT365 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 CT355 lysC, - CT362 CT365 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 CT355 lysC, - CT362 CT365 CT356 asd, - CT363 asd, - CT363 CT358 CT357
* Calculated from Protein Sequence

Gene ID: CT360

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (acidic)

Gene Start:
411902

Gene Stop:
411279

Gene Length:
624

Molecular Weight*:
24242

pI*:
4.56

Net Charge*:
-14.24

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CT360 is similar to CPn0068, a hypothetical protein: residues 41-200 are 27%
similar to CPn0068. A weak similarity in gapped BLAST to TP0494, a hypothetical from T.
pallidum: residues 37-197 are 25% similar to this uncharacterized protein. No
significant similarity to M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
22
coil-coil  
37  
67
coil-coil  
137  
164

PDB Hit:
None.

Gene Protein Sequence:
MRKAFLFGSVGCLCLLVTLESSGEGLYRGSNGRMTFISAVESANSQLELE
RKKEQRVIEILKEICKEIGVYESLFNEVTDSLEFCELLKKILAEKDSEDF
LEDVSTQDSLSSNEQPISEQTIGDRVEESAMISECMIKDVLNALQQCTES
FQRKEEEASFLERKDLELRERELAFKEERLSWEREKAEKEWAWKKEQYIR
DLVKREQK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAAAGCATTCTTGTTTGGTTCCGTCGGTTGCTTATGCTTGCTAGT
TACACTGGAAAGTAGCGGAGAGGGCCTTTATAGGGGATCTAATGGAAGGA
TGACATTCATTTCAGCAGTTGAATCAGCCAACAGTCAACTGGAGTTAGAG
AGAAAGAAAGAACAGCGTGTTATTGAGATTCTAAAAGAAATATGCAAAGA
AATTGGGGTATATGAGTCTTTATTCAATGAAGTAACAGATTCTTTGGAAT
TTTGTGAATTATTAAAAAAAATCCTTGCTGAAAAAGATTCAGAGGATTTT
TTAGAGGACGTTTCTACTCAAGATTCTTTGTCTAGCAATGAACAGCCTAT
CTCTGAGCAAACGATAGGAGATCGTGTGGAAGAGAGCGCAATGATTAGTG
AGTGCATGATAAAAGACGTTCTCAATGCTTTACAGCAATGTACAGAGTCT
TTTCAGCGCAAAGAAGAAGAGGCAAGTTTTTTGGAGAGAAAAGATTTAGA
ATTACGGGAAAGAGAGTTGGCTTTTAAAGAAGAACGATTATCTTGGGAGC
GAGAAAAAGCTGAGAAAGAATGGGCTTGGAAAAAGGAGCAATATATTCGC
GATCTTGTGAAGAGAGAGCAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy