Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR303 IGR302 IGR298 IGR299 IGR301 IGR300 IGR296 IGR297 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 CT355 lysC, - CT362 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 CT355 lysC, - CT362 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 dapB, - CT364 dapA, - CT361 CT355 lysC, - CT362 CT356 asd, - CT363 asd, - CT363 CT358 CT357
* Calculated from Protein Sequence

Gene ID: CT359

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bioY  

Definition:
probable biotin synthase

Gene Start:
411024

Gene Stop:
410437

Gene Length:
588

Molecular Weight*:
20915

pI*:
10.08

Net Charge*:
9.65

EC:
 

Functional Class:
cofactor biosynthesis; biotin and lipoic acid  

Pathway: pathway table

Comment:
The BioY protein is thought to be responsible for the
conversion of pimelate into dethiobiotin; see Ohsawa et al.,
Gene 80:39 (1989); Gloeckler et al., Gene 87:63 (1990). See
CT777 for the bioF sequence.

No similarity to CPn1044, a predicted biotin synthase in C.pneumoniae.

Blast Summary:  PSI-Blast Search
Two hits in gapped blast to hypothetical proteins of B.
subtilis (Y14084) and A. fulgidus (AE001023): residues
26-179 are 30% similar to the BACSU protein, which has similarity
to a biotin biosynthesis protein, BioY. Residues 26-184 are 28%
similar to TP0228, a predicted biotin synthase from T.pallidum.
No similarity to M.genitalium. No similarity to the C.pneumoniae BIOB
(CPn1044).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1268
COG name: Uncharacterized ACR, BioY family
Functional Class:  R
The phylogenetic pattern of COG1268 is a-tk--vc-B-------li-x
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 37-131 are 29% similar to a BioY domain seen in
BIOY_BACSH.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis. Residues 126-177
are 32% similar to a stretch of CT225, a hypothetical protein
(weak E value).

Pfam Summary:  Pfam Search
Residues 35 to 195 (E-value = 1.4e-70) place CT359 in the BioY family which is described as BioY family (PF02632)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
51
transmembrane  
55  
76
transmembrane  
81  
113
transmembrane  
126  
154
transmembrane  
158  
184

PDB Hit:
none

Gene Protein Sequence:
MVAKSITKEYSETLISNPFVKVIAGSLFLACLAKISISLPFTPVPITFQT
LGVFCLGLVMTPQMAVTTVVAYLLEGLFFPVFCSPMCGIAVFCGPTAGYL
FSFVPAVALISWLYGKFGRSEARSWVVAMILFVGGGVSLCLGALWLACFL
KSIGVSNSLDLVGAFKIGVLPFLIGKIVKIALVVQGRSVRRLFIGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGCTAAGAGCATTACTAAAGAATACTCAGAAACTCTCATAAGTAA
TCCTTTTGTGAAGGTTATCGCCGGGTCCTTGTTCTTAGCTTGTTTAGCTA
AGATCAGTATAAGTCTCCCTTTTACCCCAGTTCCTATTACATTTCAGACT
CTGGGGGTATTTTGTTTAGGGCTTGTTATGACTCCACAGATGGCTGTTAC
AACAGTAGTGGCCTATTTGTTAGAGGGGTTGTTCTTCCCTGTCTTTTGTA
GTCCTATGTGTGGGATAGCAGTGTTTTGTGGACCTACTGCTGGATATCTA
TTTTCTTTTGTACCTGCAGTAGCGCTCATTTCTTGGTTGTATGGTAAGTT
TGGAAGATCCGAAGCAAGATCGTGGGTTGTCGCGATGATTTTGTTCGTTG
GCGGAGGGGTTAGCCTCTGTTTAGGAGCTTTATGGCTTGCCTGTTTTCTG
AAGAGTATTGGAGTTTCAAACTCTCTTGATCTAGTCGGAGCTTTTAAAAT
AGGAGTTTTACCTTTTCTTATTGGTAAAATTGTGAAGATCGCTCTTGTAG
TTCAAGGACGATCTGTACGAAGATTATTTATCGGAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy