Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR302 IGR295 IGR298 IGR299 IGR301 IGR300 IGR294 IGR296 IGR297 CT357R bioY, - CT359 CT360 kgsA, - CT354 dapA, - CT361 CT355 lysC, - CT362 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 kgsA, - CT354 dapA, - CT361 CT355 lysC, - CT362 CT356 CT357 CT358 CT357R bioY, - CT359 CT360 kgsA, - CT354 dapA, - CT361 CT355 lysC, - CT362 CT356 asd, - CT363 asd, - CT363 CT358 CT357
* Calculated from Protein Sequence

Gene ID: CT357

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein (basic)

Gene Start:
409480

Gene Stop:
409809

Gene Length:
330

Molecular Weight*:
11328

pI*:
9.39

Net Charge*:
3.60

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:
No similarity to C. pneumoniae.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. No similarities to C. pneumoniae, T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis. However, residues
85-102 are 55% identical to a portion of CT445, thought
to be a glutamyl-tRNA synthetase (weak E value).

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
60
transmembrane  
64  
87

PDB Hit:
None.

Gene Protein Sequence:
MPVVQKPSVLEYAPVSPSTTSDSKIPNHRSGASCIKISMILACSLLAVGI
ILAIALLASPGSLAYVLVAGILALHAVLALALGLWISSSTKHALLSENSG
TELITIKKQQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGTAGTACAGAAACCTTCAGTTTTGGAGTACGCTCCTGTTTCTCC
TTCTACGACTTCTGATTCAAAAATACCAAACCACCGATCTGGAGCCTCTT
GTATCAAGATCTCCATGATTTTGGCATGTTCTCTTCTAGCGGTCGGCATT
ATTCTCGCAATAGCCTTGCTTGCTTCCCCTGGAAGTCTTGCCTATGTCTT
AGTAGCTGGTATATTAGCTCTTCATGCCGTTTTAGCCCTTGCTTTAGGAT
TATGGATCTCCTCATCAACCAAGCATGCACTACTGAGTGAAAACTCCGGT
ACCGAGCTGATTACAATAAAGAAACAACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy