Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR302 IGR295 IGR298 IGR299 IGR293 IGR301 IGR292 IGR300 IGR294 IGR296 IGR297 CT357R def, - CT353 bioY, - CT359 CT360 kgsA, - CT354 dapA, - CT361 CT355 lysC, - CT362 CT356 CT352 CT357 CT358 CT351 CT357R def, - CT353 bioY, - CT359 CT360 kgsA, - CT354 dapA, - CT361 CT355 lysC, - CT362 CT356 CT352 CT357 CT358 CT351 CT357R def, - CT353 bioY, - CT359 CT360 kgsA, - CT354 CT355 lysC, - CT362 CT356 dapA, - CT361 CT358 CT351 CT352 CT357
* Calculated from Protein Sequence

Gene ID: CT356

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (YYAL_BACSU related)

Gene Start:
409023

Gene Stop:
406912

Gene Length:
2112

Molecular Weight*:
80321

pI*:
5.58

Net Charge*:
-12.64

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to hypothetical bacterial proteins,
namely YYAL_BACSU,YP65_CAEEL, et al. Residues 9-694 are
30% similar to YYAL_BACSU. No similarities to T.pallidum or M.genitalium.

CT356 is similar to CPn1057, a hypothetical protein: residues 7-703
are 55% similar to CPn1057.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1331
COG name: Highly conserved protein containing a thioredoxin domain
Functional Class:  R
The phylogenetic pattern of COG1331 is a-T--q---br-------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 58-694 are 30% similar to a domain represented by hypotheical
proteins, e.g., YYAL_BACSU. Residues 9-52 are also similar to
a domain of YYAL_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 7 to 79 (E-value = 5.4e-48) place CT356 in the DUF255 family which is described as Protein of unknown function, DUF255 (PF03190)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
393  
427
non-globular  
466  
563

PDB Hit:
none

Gene Protein Sequence:
MTTDQPFTNKLITEKSPYLLLYAHTPVDWYPWSAEAFQKASAEDKPIFLS
IGCTHSKWCQVMLKENYENPEVAAILNEYFVCIKVDKEELPHLANLYFEL
SQMLSVSGEVQDSPTWPLNVFLTPNLLPFFSLGYASFAGKMGASSFVQML
EKLHIMWEDREDREVFVQQAERVLEVAAFLEGCSCKKECLEEECLKRVTE
AIYRDVDAQFGGVKSFPKILPGLLSLFLLRVGAEYQDSRAIFFVNRSLQS
VANGGIFDHLAGGFFRYTIDDRWLIPCFEKRAFDNALMMLVYTEAGVYMR
NPEFVIVAKRVLNYLIKELTDPKSGSFYLSEYGQQWAGTDIDSQYTWSGE
EIRSLLGEQAEMFCEYYDVSREGICNGRNILHVSPYMNRKEIEERYHCSL
EEFQKKLEASREKLRVYREGKTQASKDDQSFTFQNGWGIFSLIKTGILLG
EPECFVVAERCGEFIANNLYKNGRLLRRWRQGESKYSAGLEDYAAMIMGA
LALFEIGSGAKWLVLAEELAKEVLVSFRADTGGFYSTDGRDSSLLIKKAC
FVDGDAISSNALLCQGLLKLHIISGKRHYLTFAEDILQCVQGKWAKHKFS
SLGSLLAAQEYFSKQHRKIFISLGNEGDRAQVLDCFKGIFLPHTSLVWLT
AKDREILSAYLPEGEKRLIPSKEGLPTKIYLLDKDCGRVFTSLEHFYEFM
SQLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGACAGACCAGCCTTTCACGAATAAACTTATTACCGAAAAATCCCC
ATACCTTCTTCTTTATGCTCATACTCCTGTGGACTGGTACCCTTGGTCGG
CAGAAGCATTCCAAAAGGCTTCTGCAGAGGATAAACCGATTTTTTTGTCT
ATAGGGTGCACTCACTCTAAGTGGTGCCAAGTCATGCTTAAGGAAAATTA
TGAAAACCCTGAAGTTGCAGCGATTTTAAACGAGTATTTTGTTTGTATTA
AGGTAGATAAGGAAGAATTGCCTCATCTGGCAAATCTATATTTCGAATTA
TCTCAGATGCTTTCCGTATCCGGAGAGGTACAAGATTCTCCAACATGGCC
TCTGAATGTTTTCCTTACCCCCAATCTCTTGCCTTTCTTTAGCTTGGGAT
ATGCTAGCTTTGCAGGGAAAATGGGAGCCTCGTCCTTTGTCCAGATGTTG
GAAAAGTTACATATCATGTGGGAAGATCGAGAGGATAGAGAGGTATTTGT
TCAACAGGCAGAAAGAGTTCTTGAAGTAGCCGCCTTTCTAGAAGGGTGTT
CTTGTAAAAAAGAGTGTTTAGAAGAAGAATGCTTAAAGAGGGTGACAGAA
GCTATTTATCGCGATGTGGATGCGCAATTTGGAGGTGTGAAGTCATTTCC
TAAGATATTGCCTGGGTTGCTTAGTTTATTTCTTTTGCGGGTAGGAGCAG
AGTATCAAGATAGTCGGGCTATTTTTTTCGTGAATAGATCTCTACAATCT
GTGGCAAATGGGGGCATCTTTGATCATTTAGCGGGAGGTTTTTTCCGTTA
CACTATAGATGATCGTTGGTTGATTCCGTGCTTTGAAAAGCGAGCTTTTG
ACAATGCTCTTATGATGCTTGTTTATACTGAAGCCGGCGTATATATGAGA
AATCCGGAGTTCGTCATTGTAGCGAAACGGGTTCTTAATTATTTAATTAA
AGAGCTAACGGATCCTAAATCAGGATCTTTTTATCTTTCTGAATACGGTC
AACAGTGGGCAGGAACCGATATTGATAGCCAGTACACGTGGTCCGGGGAA
GAGATTCGCTCTCTGTTAGGAGAGCAAGCAGAGATGTTTTGCGAGTACTA
TGATGTGTCTAGGGAAGGAATTTGTAACGGACGGAATATCTTACACGTTT
CTCCTTACATGAATAGAAAAGAGATTGAAGAGCGTTATCATTGTTCTTTG
GAAGAATTTCAGAAGAAATTAGAAGCTTCACGAGAAAAATTACGTGTCTA
TAGGGAAGGGAAAACTCAAGCTTCCAAAGATGATCAGTCTTTCACTTTCC
AAAATGGTTGGGGAATCTTTTCTCTGATAAAAACAGGGATTCTTCTAGGA
GAACCAGAATGTTTTGTGGTGGCAGAGAGATGTGGAGAGTTTATTGCGAA
CAATCTGTATAAGAATGGCCGTTTATTGCGTCGATGGAGACAGGGAGAGT
CCAAATACTCTGCAGGATTAGAGGATTATGCTGCCATGATTATGGGAGCT
TTAGCTCTATTTGAAATAGGATCTGGGGCTAAGTGGTTGGTGCTAGCTGA
AGAGCTGGCGAAGGAAGTATTGGTGTCTTTCCGAGCCGATACAGGGGGAT
TTTATTCCACGGATGGAAGGGATTCTTCTTTGTTGATAAAGAAAGCTTGT
TTTGTAGATGGGGACGCTATATCGAGCAATGCTTTGCTTTGCCAAGGCTT
GTTGAAATTGCATATCATTTCAGGTAAACGACATTATCTAACGTTCGCAG
AAGACATTTTACAATGCGTTCAAGGAAAGTGGGCAAAACATAAATTTTCC
TCTCTGGGAAGTTTGCTTGCAGCTCAAGAGTATTTTTCCAAACAACATCG
GAAGATTTTTATTTCTTTAGGGAATGAAGGGGATAGAGCACAGGTATTAG
ATTGTTTTAAAGGGATTTTTCTTCCCCATACTTCCTTGGTTTGGTTGACT
GCCAAAGATCGTGAGATTCTAAGTGCATATCTTCCAGAGGGAGAGAAACG
ATTGATTCCTTCAAAAGAGGGGCTTCCAACAAAAATTTATCTCTTGGATA
AGGATTGTGGTAGAGTTTTTACTTCTTTAGAGCATTTCTATGAGTTTATG
TCTCAACTCAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy