Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR291 IGR295 IGR298 IGR293 IGR292 IGR294 IGR296 IGR297 CT357R def, - CT353 kgsA, - CT354 CT355 CT356 CT352 CT357 CT358 CT350 CT351 CT357R def, - CT353 kgsA, - CT354 CT355 CT356 CT352 CT357 CT358 CT350 CT351 CT357R def, - CT353 kgsA, - CT354 CT355 CT356 CT352 CT358 CT350 CT351 CT357
* Calculated from Protein Sequence

Gene ID: CT354

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kgsA  

Definition:
dimethyladenosine transferase

Gene Start:
405527

Gene Stop:
404697

Gene Length:
831

Molecular Weight*:
31415

pI*:
7.96

Net Charge*:
2.07

EC:
2.1.1.48  

Functional Class:
transcription; RNA modification  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinonebiosynthesis

Comment:
This enzyme dimethylates adjacent adenosine residues in a particular region of 16S rRNA. Inactivation of the enzyme leads to kasgamycin resistance.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to dimethyladenosine transferase
sequences, e.g., residues 8-272 are 34% similar to KSGA_BACSU. CT354
is similar to TP0337 of T.pallidum, a predicted dimethyladenosine
transferase. It is also similar to MG463 of M.genitalium, a kasgamycin
resistance protein.


COGS Summary:  COGS Search
BeTs to 17 clades of COG0030
COG name: Dimethyladenosine transferase (rRNA methylation)
Functional Class:  J
The phylogenetic pattern of COG0030 is amtkyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 35-80, 115-128, and 182-203 are matched to blocks
BL01131A,B,C, concerned with rRNA adenine dimethylation.
e.g., sequences KSGA_BACSU and KSGA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 140-200 are 39% similar to a rRNA dimethylase
domain seen in KSGA_BACSU. Residues 26-55 and 141-217
support this assignment, as exemplified by domains seen in
KSGA_BACSU and ERMA_ARTS3.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 17 to 276 (E-value = 1.6e-55) place CT354 in the RrnaAD family which is described as Ribosomal RNA adenine dimethylase (PF00398)

PDB Hit:
gi|2981999|pdb|1YUB| Solution Structure Of An Rrna Methyltransferase (Ermam) That Confers Macrolide-Lincosamide-Streptogramin Antibiotic Resistance, Nmr, Minimized Average Structure Methyltransferase, Erm, Ermam, Mls Antibiotics, Nmr, Rrna Mol_id: 1; Mol

Gene Protein Sequence:
MARSSIEQLTSFLRSVNGRAKKALSQNFLVDGNILRKILTTAEVQPGDWV
LEIGPGFGALSEVLLSQGANVIALEKDPMFEESLSQLPMDIEITDACKYP
LTSLEDKGWKGKGRIVANLPYHITTPLLTKFFLECPYRWKTVTVMIQDEV
ARRITAKPGDKDYGSLTVFLSFFADVQYAFKVSPNCFYPKPSVHSAVVHM
RVHEQFALADSEIEEFFTLTRAAFGQRRKLLANSLKNLYPKDKVFQVLEQ
LGFSEKTRPETIFLEEYLKIFHLLKDI

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCACGGAGTTCTATAGAACAGTTAACTTCTTTTCTGAGATCAGTGAA
TGGGCGAGCAAAGAAGGCTTTGTCTCAGAATTTTTTGGTAGACGGCAACA
TCTTAAGAAAAATTCTTACAACAGCAGAAGTGCAGCCAGGTGATTGGGTT
CTTGAAATTGGTCCAGGTTTCGGAGCATTATCTGAAGTTCTACTTTCTCA
AGGGGCCAATGTAATTGCTCTGGAAAAAGACCCTATGTTTGAAGAGTCTC
TGTCCCAGTTGCCAATGGATATTGAGATTACGGATGCTTGTAAATACCCT
CTGACATCCCTAGAGGATAAAGGTTGGAAAGGGAAAGGACGTATAGTAGC
GAATCTTCCCTACCATATCACTACCCCTTTATTAACCAAGTTTTTTCTAG
AATGCCCATATCGCTGGAAAACGGTTACGGTAATGATCCAAGATGAGGTG
GCTCGACGGATTACCGCCAAACCTGGAGATAAGGACTACGGCTCGTTAAC
GGTCTTTTTAAGCTTTTTCGCCGATGTGCAATATGCTTTTAAAGTTAGCC
CGAATTGTTTTTATCCCAAGCCAAGTGTGCACTCGGCTGTTGTCCATATG
CGAGTTCACGAGCAGTTTGCATTGGCTGATTCTGAAATAGAAGAGTTCTT
TACATTGACTCGAGCGGCATTTGGTCAAAGACGCAAGCTGTTAGCCAATT
CTTTGAAAAATCTGTATCCCAAAGATAAGGTCTTTCAGGTTTTGGAGCAG
TTAGGTTTTTCAGAGAAGACCAGACCCGAGACCATTTTTTTAGAAGAGTA
TTTGAAAATTTTCCACTTATTAAAAGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy