Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR291 IGR295 IGR293 IGR292 IGR294 IGR296 IGR297 def, - CT353 kgsA, - CT354 CT355 CT356 CT352 CT350 CT351 def, - CT353 kgsA, - CT354 CT355 CT356 CT352 CT350 CT351 def, - CT353 kgsA, - CT354 CT355 CT356 CT352 CT350 CT351 maf, - CT349 maf, - CT349
* Calculated from Protein Sequence

Gene ID: CT353

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
def  

Definition:
polypeptide deformylase (formylmethionine deformylase)

Gene Start:
404419

Gene Stop:
403877

Gene Length:
543

Molecular Weight*:
20507

pI*:
5.82

Net Charge*:
-2.37

EC:
3.5.1.31  

Functional Class:
translation; protein modification  

Pathway: pathway table
Amino Acid Metabolism; Methionine metabolism
Carbohydrate Metabolism; Glyoxylate and dicarboxylate metabolism

Comment:
This enzyme removes formyl groups from N-terminal methionines
of newly sequenced proteins; it requires zinc.
A 3D structure is available for the E.coli DEF protein.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to polypeptide deformylase sequences,
e.g., residues 2-173 are 37% similar to DEF_ECOLI. CT353 is similar to
TP0757, a predicted polypeptide deformylase from T.pallidum. It is
also similar to MG106 of M.genitalium.

CT353 is orthlogously related to CPn1067: residues 1-176 of CT353 are
64% similar to residues 1-176 of CPn1067, a predicted polypeptide
deformylase (formylmethionine deformylase) from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0242
COG name: N-formylmethionyl-tRNA deformylase
Functional Class:  J
The phylogenetic pattern of COG0242 is -----qvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 27-124 are 29% similar to a polypeptide deformylase domain
observed in DEF_SYNY3. Residues 129-155 are also matched
to a deformylase domain seen in DEF_THETH.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 161 (E-value = 5.5e-51) place CT353 in the Pep_deformylase family which is described as Polypeptide deformylase (PF01327)

PDB Hit:
gi|2098360|pdb|1DEF| Peptide Deformylase Catalytic Core (Residues 1 - 147), Nmr, 9 Structures Hydrolase, Zinc Metalloprotease Mol_id: 1; Molecule: Peptide Deformylase; Chain: Null; Fragment: Active Catalytic Core, Residues 1 - 147; Ec: 3.5.1.31; Engineer

Gene Protein Sequence:
MIRDLEYYDSPILRKVAAPVTEITDELRQLVLDMSETMAFYKGVGLAAPQ
VGQSISLFIMGVERELEDGELVFCDFPRVFINPVITQKSEQLVYGNEGCL
SIPGLRGEVARPDKITVSAKNLDGQQFSLALEGFLARIVMHETDHLHGVL
YIDRMSDKDKTKQFKNNLEKIRRKYSILRGL

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAGAGATCTTGAGTATTACGATAGCCCGATTTTACGTAAAGTTGC
GGCTCCTGTAACTGAAATCACGGATGAGCTGCGGCAACTCGTACTCGATA
TGAGTGAGACAATGGCTTTTTATAAGGGAGTAGGGTTAGCTGCTCCACAG
GTAGGACAAAGTATTTCTTTGTTCATTATGGGAGTAGAAAGAGAATTAGA
AGATGGGGAACTCGTTTTCTGTGATTTTCCTAGGGTATTCATTAATCCTG
TAATTACTCAAAAATCTGAGCAGTTGGTTTATGGAAATGAAGGGTGTTTA
TCCATCCCAGGATTAAGAGGAGAGGTAGCTAGACCCGATAAGATTACAGT
ATCAGCGAAAAACTTAGATGGGCAGCAGTTTTCTTTAGCTTTAGAAGGCT
TTTTAGCAAGAATTGTAATGCATGAAACTGATCATCTTCATGGCGTCTTG
TATATTGATAGAATGTCAGACAAGGACAAAACAAAACAGTTCAAGAATAA
CTTAGAAAAGATTCGTCGAAAATACAGCATTTTACGAGGTTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy