Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR283 IGR282 IGR289 IGR288 IGR286 IGR284 IGR285 IGR287 rs21, - CT342 gcp_1, - CT343 dnaJ, - CT341 odbB,pdhAB,odbA, - CT340 CT345 elaC, - CT346 xerC, - CT347 yjjK, - CT348 lon, - CT344 rs21, - CT342 gcp_1, - CT343 dnaJ, - CT341 odbB,pdhAB,odbA, - CT340 CT345 elaC, - CT346 xerC, - CT347 yjjK, - CT348 lon, - CT344 rs21, - CT342 gcp_1, - CT343 dnaJ, - CT341 odbB,pdhAB,odbA, - CT340 CT345 elaC, - CT346 xerC, - CT347 yjjK, - CT348 lon, - CT344
* Calculated from Protein Sequence

Gene ID: CT344

DNA Molecule Name:
1  

Genbank ID:
3328764

Gene Name:
lon  

Definition:
ATP-dependent protease LA

Gene Start:
392089

Gene Stop:
394545

Gene Length:
2457

Molecular Weight*:
91928

pI*:
7.41

Net Charge*:
3.06

EC:
3.4.21.-  

Functional Class:
translation; proteases  

Pathway: pathway table

Comment:
Lon proteins degrade (hydrolyze using ATP) large proteins such as globin and casein.

See CT841, CT286, CT113, CT705.

For review, see, "Proteases and Their Targets in Escherichia coli. 1996. Gottesman, S. Ann. Rev. Genetics 30: 465-506. Medline: 8982462.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to lon-related sequences, e.g., residues 18-818 are 38% similar to the E.coli ATP-dependent protease LA (U82664) and 39% similar to LON_ECOLI. CT344 is weakly similar to CT841, CT286, CT113, and CT705, all thought to be ATPases. The extent of similarity is about the same in all case: 20-30% over the middle residues of CT344. Residues 7-817 are 45% similar to TP0524 of T.pallidum, a predicted LA protease.
CT344 is also similar to MG239 of M.genitalium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0466
COG name: ATP-dependent Lon protease, bacterial type
Functional Class:  O
The phylogenetic pattern of COG0466 is ----yqv-eb-hujgpOlinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Five domains are covered by residues 252-509 matching blocks BL01046A,B,C,D, which are concerned with ATP-dependent serine protease sequences, e.g., LON_BORBU and LONM_SCHPO. Residues 387-402 are also representative of a domain seen in block PR00364A, concerned with disease resistance proteins.
Residues 361-406 and 482-510 may belong to blocks BL00870A,H, which encompass CLP-related sequences. Residues 388-421 have some match to block BL01128A, e.g., AROK_BACSU. Residues 103-139 and 357-641 are represented in six blocks, BL00674A,B,C,D,E, concerned
with AAA-protein family sequences.

ProDom Summary:  Protein Domain Search
Residues 197-715 are 53% similar to a domain represented by ATP-dependent LA precursor proteins, e.g. LONN_HUMAN, LON_BORBU, LON_ECLOI. Residues 41-207, 349-541, 361-419, and 748-785 also correspond to well-defined domains such as those seen in LONM_YEAST, LONM_SCHPO, CFXQ_ODOSI, and PROL_ARATH.

Paralogs:  Local Blast Search
CT344 is weakly similar to CT841, CT286, CT113, and CT705,
sequences predicted to have ATPase activities: residues
359-465 are 29% similar to CT841; residues 166-582 are
20% similar to CT286, residues 387-510 and 351-406 are
25% and 32% similar, respectively, to CT113, and residues
350-506 are 25% similar to CT705.

Pfam Summary:  Pfam Search
Residues 41 to 237 (E-value = 5.2e-20) place CT344 in the LON family which is described as ATP-dependent protease La (LON) domain (PF02190)
Residues 387 to 582 (E-value = 8.8e-48) place CT344 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 611 to 818 (E-value = 1.1e-107) place CT344 in the Lon_C family which is described as Lon protease (S16) C-terminal proteolytic domain (PF05362)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
139  
173
coil-coil  
249  
293
coil-coil  
578  
607
non-globular  
714  
819

PDB Hit:
None.

Gene Protein Sequence:
MNSTNNTDSQNLDPNASEVEKLLDESAEAEEKVDDHTPPSELFILPLNKR
PFFPGMAAPLLIEAGPHYEVLTLLAKSSQKHIGLVLTKKEDANTLKVGFN
QLHRVGVSARILRIMPIEGGSAQVLLSIEDRIRIVKPIQDKYLKAKVSYH
KENKELTEELKAYSISIVSIIKDLLKLNPLFKEELQIFLGHSDFTEPGKL
ADFSVALTTATREELQEILETTDMHDRIDKALVLLKKELDLSRLQSSINQ
KIEATITKSQKEFFLKEQLKTIKKELGLEKDDHAVDLEKFMERFNKRDVP
QYAMDVIQDEMDKLQTLETSSAEYAVCRNYLDWLTIVPWGIQTKEYHDLK
KAESILNKDHYGLEDIKQRILELISVGKLANGMKGSIICLVGPPGVGKTS
IGRSIAKVLHRKFFRFSVGGMRDEAEIKGHRRTYIGAMPGKLVQALKQSQ
IMNPVIMIDEVDKIGSSYHGDPASALLEVLDPEQNKDFLDHYLDVRVDLS
NVLFILTANVLDSIPDPLLDRMEVLRLSGYILEEKLQIATKYLVPRARKE
MGLSAQNVTFQPEALKHMINNYAREAGVRTLNENIKKVLRKVALKIVQNQ
EKNLSKKSRFTITPKNLQDYLGKPVFSSDRFYEKTPVGVATGLAWTSLGG
ATLYIESVQVPSSSGKADMHLTGQAGDVMKESSQIAWTYLHSALERYAPG
QPFFEKSQVHIHIPEGATPKDGPSAGITMVTSLLSLLLDVPVLNNLGMTG
ELTLTGRVLGIGGIREKLIAARRSKLNILIFPEDNRRDYDELPAYLKKGL
KVHFVTHYDDVFKIAFPGV

Gene Nucleotide Sequence:  Sequence Viewer
GTGAACTCGACGAATAATACAGACTCTCAAAATCTAGATCCAAATGCTTC
AGAGGTCGAAAAACTTCTCGACGAATCCGCAGAGGCAGAAGAGAAAGTAG
ATGATCATACGCCCCCTTCAGAACTTTTTATTCTCCCTCTGAATAAGCGT
CCTTTTTTCCCTGGTATGGCAGCCCCTCTCCTTATAGAGGCAGGCCCCCA
TTATGAAGTACTTACACTATTAGCAAAATCATCCCAGAAACACATCGGTC
TTGTCTTAACAAAAAAAGAAGATGCCAACACTCTAAAAGTTGGTTTTAAT
CAGCTTCATCGAGTGGGCGTATCCGCGCGCATTTTACGCATAATGCCTAT
TGAAGGCGGTAGCGCTCAAGTGTTATTGAGTATAGAAGACCGTATTCGCA
TCGTTAAGCCAATTCAAGATAAGTATCTAAAAGCCAAAGTCTCCTATCAC
AAAGAGAACAAAGAGCTGACTGAAGAGCTAAAAGCTTACTCAATTAGCAT
CGTATCGATTATCAAAGATCTTCTAAAACTAAACCCTCTGTTCAAAGAAG
AGCTACAAATTTTCCTTGGCCACTCTGATTTCACTGAGCCAGGGAAACTC
GCAGATTTCTCCGTTGCTTTAACTACAGCAACACGAGAGGAACTTCAGGA
AATTTTAGAAACCACAGACATGCATGATCGCATAGACAAAGCATTGGTCT
TACTCAAAAAAGAGTTAGATCTAAGCCGTCTGCAAAGTAGTATCAATCAA
AAAATTGAAGCGACCATCACAAAAAGTCAGAAAGAATTTTTCCTAAAAGA
ACAACTTAAAACAATAAAGAAAGAGTTAGGGCTAGAGAAAGACGATCACG
CTGTTGATCTTGAGAAGTTTATGGAACGCTTCAATAAACGAGACGTTCCT
CAATACGCCATGGACGTTATCCAAGATGAAATGGATAAATTACAAACCTT
GGAGACTTCTTCAGCTGAATATGCAGTCTGCCGCAACTATCTCGATTGGT
TAACTATTGTACCTTGGGGTATCCAAACCAAGGAATACCACGATTTGAAG
AAAGCAGAATCTATCTTAAATAAAGACCATTACGGTTTAGAAGATATAAA
ACAACGCATTCTTGAATTGATTAGTGTAGGCAAACTAGCAAACGGTATGA
AGGGAAGTATTATTTGCCTAGTGGGGCCTCCAGGAGTAGGGAAAACAAGT
ATCGGCCGAAGTATTGCAAAAGTGTTACACCGTAAATTCTTCCGGTTCTC
TGTAGGAGGAATGCGTGATGAAGCAGAAATCAAAGGACATAGACGGACCT
ATATCGGAGCTATGCCAGGGAAACTTGTGCAAGCTTTGAAACAAAGTCAG
ATTATGAATCCTGTGATCATGATTGATGAAGTCGATAAAATTGGCTCTAG
TTATCACGGAGATCCAGCTTCGGCCCTTCTTGAGGTATTAGATCCCGAAC
AAAACAAAGACTTTTTAGATCATTATTTGGATGTCCGCGTAGATTTATCT
AACGTGCTCTTCATTCTAACCGCAAACGTATTAGATTCCATCCCAGACCC
TCTACTGGACCGAATGGAAGTATTGCGTTTATCTGGTTACATTCTGGAAG
AAAAATTACAGATAGCCACTAAATACCTCGTACCTCGCGCAAGGAAAGAG
ATGGGACTTTCTGCACAGAATGTGACTTTCCAACCAGAAGCTCTCAAGCA
CATGATCAACAACTATGCTAGAGAAGCTGGAGTTCGTACACTGAATGAAA
ACATTAAGAAAGTCTTACGAAAAGTAGCTCTTAAAATTGTTCAAAACCAA
GAGAAAAATCTTTCCAAGAAGTCGCGGTTTACAATCACGCCAAAAAATCT
ACAAGATTATCTTGGCAAACCAGTCTTTTCTAGCGATCGTTTCTATGAAA
AGACTCCGGTAGGAGTTGCCACAGGCCTAGCATGGACTTCCTTAGGAGGA
GCAACCTTGTACATAGAAAGTGTTCAAGTCCCTTCTTCATCAGGTAAAGC
GGATATGCATCTAACAGGTCAAGCTGGGGATGTGATGAAAGAGTCTTCAC
AAATAGCATGGACCTATCTTCATAGTGCTCTAGAACGTTATGCTCCAGGA
CAACCATTCTTTGAAAAATCGCAAGTCCATATCCATATCCCAGAGGGAGC
CACTCCAAAAGACGGTCCCTCTGCAGGAATTACTATGGTAACGTCCTTGC
TTTCTTTACTTTTGGATGTTCCTGTGCTTAATAACCTCGGCATGACTGGA
GAGCTCACCTTAACAGGCAGAGTTTTAGGAATTGGAGGTATCCGGGAAAA
ACTTATCGCAGCAAGAAGATCGAAATTGAATATTTTAATCTTCCCTGAAG
ATAACCGTCGAGATTACGACGAGCTCCCCGCATACCTTAAGAAAGGTCTC
AAGGTACACTTCGTCACCCATTATGACGATGTATTCAAGATTGCTTTCCC
TGGGGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy