Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR281 IGR279 IGR276 IGR280 ptsH, - CT337 CT338 ptsI, - CT336 odbB,pdhAB,odbA, - CT340 dnaX2, - CT334 CT339 uvrA, - CT333 ptsH, - CT337 CT338 ptsI, - CT336 odbB,pdhAB,odbA, - CT340 dnaX2, - CT334 CT339 uvrA, - CT333 ptsH, - CT337 CT338 ptsI, - CT336 odbB,pdhAB,odbA, - CT340 dnaX2, - CT334 CT339 uvrA, - CT333 ybaB, - CT335 ybaB, - CT335
* Calculated from Protein Sequence

Gene ID: CT336

DNA Molecule Name:
1  

Genbank ID:
3328755

Gene Name:
ptsI  

Definition:
PEP protein phosphotransferase

Gene Start:
384683

Gene Stop:
382971

Gene Length:
1713

Molecular Weight*:
63777

pI*:
6.28

Net Charge*:
-5.47

EC:
2.7.3.9  

Functional Class:
translation; protein modification  
transport and binding; carbohydrates  

Pathway: pathway table
Membrane Transport; Phosphotransferase system

Comment:
CT336 appears to be a component of the PEP-dependent system (PTS), an active transport system for carbohydrates. In E.coli, the molecule (for which a 3D structure is available) is a homodimer. See CT337.

From Prosite PDOC00527:

This is the first enzyme of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate transport system in bacteria. The PTS catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is the following: a phosphoryl group from PEP is transferred to enzyme-I (EI) of PTS which in turn transfers it to a phosphoryl carrier protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to PEP phosphotransferase sequences, e.g.,
residues 13-569 are 26% similar to PT1_BACSU. CT336 is similar to TP0746
of T.pallidum, a predicted PEP-protein phosphatase. Residues 17-569 are
27% similar to MG429 in M.genitalium.

CT336 is orthologously related to CPn0038: residues of 13-569 CT336 are 59% similar to residues 10-563 of CPn0038, a predicted PTS PEP Phosphotransferase from C. pneumoniae.
CT336 is also similar to MP0215, TP0575, both predicted phosphoenolpyruvate-protein phosphotransferases.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1080
COG name: Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria)
Functional Class:  G
The phylogenetic pattern of COG1080 is --------Eb-h--gpo-in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 196-202, 304-316, 320-356, 396-406, 433-469, 500-523 are
significantly matched to blocks BL00370A,B,D,E,F, which encompass
PEP-utilizing proteins, e.g., PPSA_PYRFU, PT1_ALCEU, et al.

ProDom Summary:  Protein Domain Search
Residues 60-198 are 30% similar to a phosphotransferase enzyme I system
domain as observed in PT1_MYCCA. Residues 384-465 and 482-542 also
have matches to domains of this protein, e.g., in PT1_ECOLI and PT1_ALCEU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 17 to 134 (E-value = 1.2e-13) place CT336 in the PEP-utilisers_N family which is described as PEP-utilising enzyme, N-terminal (PF05524)
Residues 155 to 246 (E-value = 4.4e-21) place CT336 in the PEP-utilizers family which is described as PEP-utilising enzyme, mobile domain (PF00391)
Residues 262 to 546 (E-value = 7e-37) place CT336 in the PEP-utilizers_C family which is described as PEP-utilising enzyme, TIM barrel domain (PF02896)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
48  
75

PDB Hit:
gi|1942893|pdb|1ZYM|A Chain A, Amino Terminal Domain Of Enzyme I From Escherichia Coli Phosphotransferase Mol_id: 1; Molecule: Enzyme I; Chain: A, B; Fragment: Amino-Terminal Domain Residues 1 - 258; Ec: 2.7.3.9; Engineered: Yes

Gene Protein Sequence:
MSVTGQDNKELQQEFVIVGEPIVPGIGLGKALLLGKSSLRIRELTLPQEE
VEHEISRYYKALKRSRSDLAALEKEAKGKQGYQEIASILQAHLEIIKDPL
LTEEVVKTIRKDRKNAEFVFSSVMGEIEKSLCAVQKTTATRVDRVQDIHD
ISNRVIGHLCCQHKSSLGEFDQNLIVFSEELTPSEAANANPEYIRGFVSL
EGAKTSHTAIVSLAKNIPYVANFTTELWDTIKEFSGTLVLINGDKGEITF
NPQLSTIQTYYRKQASVSVTVPVQVQTGKNLPLISLSAQIVSTEELPMIE
RESPGTSVGLFRSEFMAFSLGRLPCVEEQADQYAQLVQFQCSDIHVLRLF
DFGEDKECPCISSSHRSVRWLLEQEKVLKEQLQAIAIVSRIGRLKVLIPG
VIDASEIALVKRLFQEEIRLLKGISENILWGSMIEIPSAVWMIEEILQES
SFVALGTNDLAQYTLGTSRERSLLGERSRVPHPSVIRMIHHVVEQAKQKN
VPVSVCGEMAGDPALLPMFLGLGVKELSAVIPAINSLKMRLLDLNSRECS
RLTKQLLRAKTYEEVHQLLYV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGTTACGGGTCAAGATAATAAGGAGTTGCAACAGGAGTTTGTTAT
TGTAGGGGAGCCTATAGTCCCTGGAATAGGGCTAGGGAAAGCTTTATTGT
TGGGCAAATCTTCTTTGCGGATACGAGAGCTAACTCTTCCTCAAGAAGAA
GTGGAACATGAGATCAGTCGCTACTACAAGGCTTTGAAGAGATCTCGTTC
AGATCTAGCTGCTTTAGAAAAAGAAGCAAAGGGAAAGCAGGGATATCAAG
AGATAGCTTCCATTTTGCAGGCACATCTAGAAATTATAAAAGACCCTCTT
CTCACGGAAGAGGTGGTTAAAACAATTAGAAAAGATCGAAAGAATGCGGA
GTTTGTTTTTTCTTCTGTCATGGGAGAGATAGAGAAATCTCTATGTGCTG
TACAGAAGACGACTGCTACCAGAGTAGATCGAGTTCAGGATATCCATGAT
ATTTCTAATCGAGTGATTGGCCATCTTTGTTGTCAGCATAAGAGTTCTTT
AGGGGAGTTTGATCAGAATCTTATTGTCTTTTCGGAAGAGCTTACTCCCT
CGGAAGCCGCAAATGCTAATCCCGAGTACATCAGGGGCTTTGTATCTTTA
GAGGGCGCAAAAACTTCGCATACCGCGATTGTATCTTTGGCTAAAAATAT
TCCTTATGTTGCCAATTTTACTACAGAGTTATGGGATACTATTAAAGAGT
TTAGTGGGACATTAGTTCTCATTAATGGGGATAAGGGAGAGATTACGTTT
AATCCTCAGCTAAGTACGATACAAACTTATTATCGTAAGCAAGCGTCTGT
TTCTGTCACTGTTCCAGTGCAGGTGCAGACAGGGAAAAATCTGCCTCTTA
TCTCTCTCTCAGCACAGATAGTAAGTACAGAAGAATTGCCCATGATTGAA
AGGGAGTCTCCAGGGACAAGTGTTGGGCTCTTCCGTTCAGAATTTATGGC
TTTTTCTTTGGGACGCTTACCCTGTGTTGAAGAACAAGCTGATCAATATG
CTCAATTAGTTCAGTTTCAGTGTTCAGATATTCATGTATTGCGTTTGTTT
GATTTTGGAGAGGATAAAGAGTGTCCTTGTATTTCCTCTTCTCATCGGTC
AGTACGGTGGTTATTAGAACAAGAAAAAGTATTGAAGGAGCAGTTGCAGG
CTATTGCTATTGTTTCTAGAATAGGACGACTTAAGGTATTGATTCCTGGG
GTGATAGATGCTTCAGAAATTGCTTTAGTAAAGCGGCTTTTTCAAGAAGA
AATTCGGCTATTGAAAGGGATCAGTGAAAATATCTTATGGGGAAGCATGA
TAGAGATCCCTTCTGCAGTTTGGATGATAGAGGAAATTTTACAAGAGAGT
TCTTTTGTAGCTTTAGGTACTAATGATCTTGCTCAGTATACTTTAGGCAC
TTCTAGAGAGCGTTCCTTACTTGGGGAGCGGAGTAGAGTGCCGCATCCTT
CTGTTATTAGAATGATTCATCATGTTGTAGAGCAGGCTAAACAGAAGAAT
GTTCCCGTATCTGTATGTGGAGAGATGGCAGGAGACCCTGCTCTTCTGCC
TATGTTTTTAGGACTAGGGGTAAAGGAGTTATCAGCTGTCATCCCAGCAA
TAAATTCTTTGAAAATGCGATTATTAGATTTGAACTCAAGGGAGTGCTCT
CGTTTAACGAAGCAGTTATTGCGGGCGAAAACATACGAAGAGGTTCATCA
ACTCCTGTATGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy