Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR272 IGR275 IGR274 IGR273 CT330 tpiS,tpiA, - CT328 pk,pykF, - CT332 xseA, - CT329 dxs,tkt, - CT331 uvrA, - CT333 CT330 tpiS,tpiA, - CT328 pk,pykF, - CT332 xseA, - CT329 dxs,tkt, - CT331 uvrA, - CT333 CT330 tpiS,tpiA, - CT328 pk,pykF, - CT332 xseA, - CT329 dxs,tkt, - CT331 uvrA, - CT333
* Calculated from Protein Sequence

Gene ID: CT332

DNA Molecule Name:
1  

Genbank ID:
3328751

Gene Name:
pk  pykF  

Definition:
pyruvate kinase

Gene Start:
374217

Gene Stop:
375671

Gene Length:
1455

Molecular Weight*:
53675

pI*:
6.37

Net Charge*:
-3.79

EC:
2.7.1.40  

Functional Class:
energy metabolism; pyruvate metabolism, glycolysis and gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pyruvate metabolism
Energy Metabolism; Carbon fixation

Comment:
This enzyme interconverts phosphoenolpyruvate and pyruvate. Magnesium and potassium are said to be required for the reaction. 3D structures are available for eukaryotic enzymes.

From Prosite PDOC00101:

Pyruvate kinase (EC 2.7.1.40) (PK) catalyzes the final step in glycolysis, the conversion of phosphoenolpyruvate to pyruvate with the concomitant phosphorylation of ADP to ATP. PK requires both magnesium and potassium ions for its activity. PK is found in all living organisms. In vertebrates there are four, tissues specific, isozymes: L (liver), R (red cells), M1 (muscle, heart, and brain), and M2 (early fetal tissues). In Escherichia coli there are two isozymes: PK-I (gene pykF) and PK-II (gene pykA). All PK isozymes seem to be tetramers of identical subunits of about 500 amino acid residues.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to pyruvate kinase sequences, e.g., residues
3-468 are 38% similar to the human enzyme (M26252). Many of the hits with
high E values are to eukaryotic enzymes. CT332 is near-perfectly matched
to U83196 from C.trachomatis. CT332 is similar to MG216 of M.genitalium, a predicted
pyruvate kinase. No similarity to T.pallidum.

CT332 is orthologously related to CPn0097:
residues 1-479 are 73% similar to that of CPn0097.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0469
COG name: Pyruvate kinase
Functional Class:  G
The phylogenetic pattern of COG0469 is -m-kY-vCEbrh--gpo-in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 9-52, 62-76, 107-133, 147-194, 149-200, 217-268, 269-320, 377-421,
399-443, and 355-399 are significantly matched to blocks BL00110A,B,C,D,E,F,G,
which encompass pyruvate kinase sequences, e.g., KPYC_SOLTU, KPYK_BACPY,
KPYK_BACST, et al.

ProDom Summary:  Protein Domain Search
Residues 4-453 are 45% similar to a pyruvate kinase domain observed in
KPYK_BACST.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 344 (E-value = 5.2e-137) place CT332 in the PK family which is described as Pyruvate kinase, barrel domain (PF00224)
Residues 359 to 471 (E-value = 7.5e-12) place CT332 in the PK_C family which is described as Pyruvate kinase, alpha/beta domain (PF02887)

PDB Hit:
gi|1310978|pdb|1PKY|A Chain A, Pyruvate Kinase From E. Coli In The T-State Allostery Mol_id: 1; Molecule: Pyruvate Kinase; Chain: A, B, C, D; Ec: 2.7.1.40; Other_details: T State

Gene Protein Sequence:
MIARTKIICTIGPATNTPEMLEKLLDAGMNVARLNFSHGTHESHGRTIAI
LKELREKRQVPLAIMLDTKGPEIRLGQVESPIKVQPGDRLTLVSKEILGS
KESGVTLYPSCVFPYVRERAPVLIDDGYIQAVVVNAQEHMVEIEFQNSGE
IKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDID
SMRKVLESFGRPNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIEL
SIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTRAEVSDVANA
IYDGTSAVMLSGETALGAHPVHAVKTMRSIIQETEKTFDYHAFFQLNDKN
SALKVSPYLEAIGFSGIQIAEKASAKAIIVYTQTGGSPMFLSKYRPYLPI
IAVTPNRNVYYRLAVEWGVYPMLTLESNRTVWRHQACVYGVEKGILSNYD
KILVFSRGAGMQDTNNLTLTTVHDVLSPSLDEIVP

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCGCTAGAACGAAAATTATTTGTACGATAGGCCCTGCAACGAATAC
CCCTGAGATGCTGGAAAAGCTTCTTGATGCAGGGATGAATGTAGCTCGCC
TTAATTTTAGCCACGGGACCCATGAAAGCCATGGCCGGACCATCGCTATT
CTTAAAGAACTACGAGAGAAGCGCCAAGTTCCTTTAGCTATTATGCTAGA
TACAAAAGGTCCCGAAATTCGTTTAGGCCAAGTAGAATCTCCTATAAAAG
TACAGCCTGGGGATCGTCTTACTCTCGTTAGCAAAGAAATTTTAGGATCC
AAAGAAAGCGGCGTTACTCTTTATCCAAGTTGTGTATTCCCTTATGTTAG
AGAACGAGCTCCTGTTCTCATTGATGATGGGTATATCCAAGCAGTGGTGG
TCAATGCTCAAGAGCATATGGTGGAAATAGAGTTTCAAAATTCAGGAGAA
ATAAAATCCAACAAATCTCTTAGCATCAAAGATATCGATGTTGCTCTTCC
TTTCATGACAGAGAAGGATATTGCAGACTTAAAATTTGGGGTAGAACAAG
AACTCGATCTTATCGCTGCTTCGTTCGTCAGATGTAATGAAGATATTGAC
AGCATGCGTAAAGTTTTGGAAAGCTTTGGTCGTCCTAATATGCCCATCAT
TGCTAAAATAGAAAATCATTTAGGAGTACAAAATTTCCAAGAGATCGCTA
GAGCTGCTGATGGTATCATGATTGCACGCGGGGATCTTGGTATTGAATTG
TCTATTGTTGAAGTTCCTGGACTACAAAAATTTATGGCCCGAGCATCGAG
GGAAACGGGTCGGTTTTGTATCACTGCAACGCAAATGCTCGAGTCAATGA
TTCGCAACCCCCTTCCTACACGAGCCGAAGTCTCTGACGTTGCCAACGCC
ATTTACGATGGAACCTCTGCAGTCATGTTGTCTGGAGAAACTGCCTTAGG
AGCCCATCCTGTACATGCAGTAAAAACAATGCGTTCCATTATCCAAGAGA
CTGAGAAGACTTTCGATTACCACGCTTTTTTCCAGCTGAACGACAAAAAC
AGCGCTCTCAAAGTTTCTCCTTATCTTGAAGCCATTGGGTTTTCTGGAAT
CCAAATTGCAGAAAAAGCATCTGCCAAAGCCATTATTGTGTATACCCAGA
CGGGAGGATCTCCGATGTTTTTATCCAAATATCGACCTTATCTCCCTATT
ATTGCTGTTACCCCTAACCGCAATGTGTACTATCGTTTAGCTGTAGAATG
GGGAGTATATCCTATGCTAACCCTAGAATCGAACCGTACAGTCTGGCGTC
ACCAAGCTTGTGTATATGGAGTAGAAAAAGGAATTCTTTCTAACTATGAT
AAAATTCTTGTCTTCAGCCGCGGAGCTGGGATGCAAGACACCAACAATCT
CACCTTGACAACTGTGCATGATGTGCTATCCCCCTCTCTTGACGAGATAG
TTCCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy