Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR272 IGR275 IGR274 IGR270.1 IGR271 IGR273 IGR270.2 CT326.2 trpC, - CT327 CT326 CT330 tpiS,tpiA, - CT328 pk,pykF, - CT332 xseA, - CT329 dxs,tkt, - CT331 uvrA, - CT333 CT326.2 trpC, - CT327 CT326 CT330 tpiS,tpiA, - CT328 pk,pykF, - CT332 xseA, - CT329 dxs,tkt, - CT331 uvrA, - CT333 trpC, - CT327 CT326 CT326.1 CT326.2 CT326.1 CT330 tpiS,tpiA, - CT328 pk,pykF, - CT332 xseA, - CT329 dxs,tkt, - CT331 uvrA, - CT333
* Calculated from Protein Sequence

Gene ID: CT329

DNA Molecule Name:
1  

Genbank ID:
3328747

Gene Name:
xseA  

Definition:
exodeoxyribonuclease VII large subunit

Gene Start:
370170

Gene Stop:
371717

Gene Length:
1548

Molecular Weight*:
58610

pI*:
10.26

Net Charge*:
23.26

EC:
3.1.11.6  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to exodeoxyribonuclease VII large chain sequences,
e.g., residues 5-508 are 31% similar to the NCEC7 enzyme from E.coli. No
similarities to T.pallidum or M.genitalium. Similar to PG1009 of P.gingivalis.

CT329 is orthologously related to CPn1062, a predicated exodeoxyribonucleae VIII large subunit: residues 3-508 are 51% similar to residues 1-546 of CPn1062.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1570
COG name: Exonuclease VII, large subunit
Functional Class:  L
The phylogenetic pattern of COG1570 is ------v-ebrhUj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
No significant matches. Residues 43-52 have a weak match to block BL00443D,
glutamine amidotransferase, e.g., ASN1_YEAST.

ProDom Summary:  Protein Domain Search
Residues 21-387 are 37% similar to an exonuclease VII domain as observed in
EX7L_HAEIN (large subunit).

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 28 to 103 (E-value = 2.9e-06) place CT329 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 197 to 435 (E-value = 2.3e-155) place CT329 in the Exonuc_VII_L family which is described as Exonuclease VII, large subunit (PF02601)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
349  
459

PDB Hit:
none

Gene Protein Sequence:
MSITSPPIEVSVLTDSIKNLLEKNFLRVVVKGELSNVSLQTSGHLYFAIK
DSKAVLNGAFFHFRSKYFDRKPKDGDYVILHGKLTVYAPRGQYQIVAYAL
TFSGEGNLLQQFEERKQRLAAEGYFDPKRKKPLPSGARVIGVITSPTGAV
IQDILRVLSRRCHQFQVILYPVTVQGATAAQEISQAIQFFNQNSMGVHAL
IIARGGGSIEDLWAFNEEELVKSIVASSIPIISAVGHETDFTLCDFASDV
RAPTPSAAAEIVCKSSDQYRQELQNLRRYVLSHARQFIAAKKNLLTHWQR
HLASVDFYHTAQQTLDYTRAALERGIETKLEYYKQRFAQYRRWLKSDVLI
RIEKHLADLNQSLMLSIKNKIYTKKTSLNQLYTSCLKNELLNLQHHTQHS
RNILSQLSRRLHIAIASSQQTHQECLVRLQNELSFTIHHLLTKAKERCQA
IQEQASSLNPKNVLKRGFAQLFDFNKHFVIISAESLKQSDLVRVCLQDGE
AVVSVKEVWLNNDKKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGATCACATCCCCTCCTATAGAAGTTTCTGTCCTGACAGATTCTAT
TAAGAATCTTTTAGAAAAAAATTTTCTTCGCGTAGTGGTTAAAGGAGAAC
TTAGTAACGTCTCTTTACAAACAAGCGGTCACTTATATTTTGCTATCAAA
GATAGCAAGGCTGTACTTAACGGAGCTTTTTTTCATTTCCGTAGCAAATA
CTTTGACCGCAAACCAAAAGATGGCGACTACGTGATTCTTCATGGGAAAC
TCACAGTCTATGCTCCTAGAGGACAATACCAGATTGTGGCCTATGCTCTC
ACCTTCTCCGGAGAAGGTAATTTGCTGCAACAATTCGAAGAACGCAAACA
ACGTCTCGCTGCTGAGGGATATTTCGATCCTAAACGCAAAAAGCCTCTTC
CTTCAGGAGCTCGCGTAATAGGGGTGATTACAAGCCCTACAGGGGCTGTA
ATTCAAGATATTTTACGAGTTCTTTCTCGCCGTTGTCACCAATTTCAAGT
CATCTTATATCCAGTGACGGTACAAGGAGCTACTGCGGCTCAAGAGATTT
CTCAGGCTATTCAATTTTTCAATCAAAACAGTATGGGGGTCCACGCTCTT
ATCATCGCAAGGGGCGGTGGAAGTATCGAGGATCTCTGGGCTTTTAATGA
AGAAGAGCTAGTTAAATCTATTGTAGCAAGCTCCATTCCTATTATTTCTG
CTGTTGGTCACGAGACTGATTTCACTCTCTGCGACTTTGCATCCGATGTT
CGTGCTCCGACCCCCTCTGCAGCAGCAGAAATTGTATGTAAGAGTAGTGA
TCAATACCGCCAAGAACTGCAAAATCTACGGCGCTACGTCTTGTCTCATG
CAAGACAATTTATTGCAGCTAAAAAAAACCTTCTCACTCATTGGCAAAGA
CATCTTGCTTCAGTAGATTTCTACCACACAGCACAACAAACTTTAGATTA
CACCCGAGCGGCCTTAGAAAGAGGGATAGAAACCAAACTTGAATACTATA
AACAACGATTTGCGCAATATAGACGCTGGTTGAAAAGCGATGTTTTGATT
CGTATAGAAAAACATTTGGCGGATCTGAACCAATCTCTTATGCTTTCTAT
AAAAAATAAAATTTATACAAAAAAAACCTCTCTAAACCAGCTATACACTT
CTTGTCTCAAAAATGAACTACTGAATTTACAGCACCACACGCAGCACTCG
CGGAATATTTTAAGCCAGCTATCTAGGAGGCTGCATATCGCGATTGCAAG
CTCACAACAAACTCACCAAGAGTGTTTGGTTCGTCTTCAGAACGAACTTT
CTTTCACAATACACCACCTGCTAACTAAGGCGAAAGAACGGTGCCAGGCT
ATACAAGAACAAGCTTCCTCACTAAATCCAAAAAATGTTTTAAAAAGAGG
TTTTGCCCAGCTCTTTGACTTTAATAAACACTTTGTTATCATCTCTGCGG
AATCTCTTAAACAAAGCGATCTTGTGCGGGTCTGCCTCCAAGACGGTGAA
GCAGTTGTATCAGTAAAAGAAGTTTGGCTTAACAATGACAAAAAAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy