Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Met-3 IGR272 IGR269 IGR270.1 IGR271 IGR273 IGR268 IGR270.2 CT326.2 trpC, - CT327 CT326 CT330 CT325 tpiS,tpiA, - CT328 CT324 xseA, - CT329 dxs,tkt, - CT331 CT326.2 trpC, - CT327 CT326 CT330 CT325 tpiS,tpiA, - CT328 CT324 xseA, - CT329 dxs,tkt, - CT331 trpC, - CT327 CT326 CT326.1 CT326.2 CT326.1 CT330 CT325 tpiS,tpiA, - CT328 CT324 xseA, - CT329 dxs,tkt, - CT331
* Calculated from Protein Sequence

Gene ID: CT327

DNA Molecule Name:
1  

Genbank ID:
3328745

Gene Name:
trpC  

Definition:
phosphoribosylanthranilate isomerase

Gene Start:
369135

Gene Stop:
368512

Gene Length:
624

Molecular Weight*:
22724

pI*:
5.01

Net Charge*:
-6.93

EC:
5.3.1.24  

Functional Class:
amino acid biosynthesis; aromatic  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis

Comment:
The anthranilate isomerase enzyme converts N-5'-phosphoribosyl-
anthranilate to 1-(2-carboxyphenylamino)-1-desoxy ribulose
5-phosphate (3rd step in tryptophan biosynthesis).
No similarity to C.pneumoniae.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to anthranilate isomerase sequences,
e.g., residues 4-210 are 30% similar to the E.coli enzyme
as seen in U23499. No similarities to T.pallidum or M.genitalium.
No similarity to C.pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0135
COG name: Phosphoribosylanthranilate isomerase
Functional Class:  E
The phylogenetic pattern of COG0135 is amt--qvceb-huj----i--
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-201 are 33% similar to an anthranilate isomerase domain
as observed in TPRF_THEMA. Residues 2-86, 4-49, 128-190 also
correspond to well-defined anthranilate isomerase domains as
seen in TRPF_PSEAE, TRPG_PHYBL, TRPF_SYNY3.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 199 (E-value = 9.6e-24) place CT327 in the PRAI family which is described as N-(5'phosphoribosyl)anthranilate (PRA) isomerase (PF00697)

PDB Hit:
gi|1941978|pdb|1NSJ| Crystal Structure Of Phosphoribosyl Anthranilate Isomerase From Thermotoga Maritima Isomerase, Phosphoribosyl Anthranilate Isomerase, Thermostability Mol_id: 1; Molecule: Phosphoribosyl Anthranilate Isomerase; Chain: Null; Synonym: P

Gene Protein Sequence:
MKVKICGITHPDDAREAAKAGADYIGMIFAKDSRRCVSEEKAKYIVEAIQ
EGNSEPVGVFPEHSVEEILAITETTGITSIQLSGEDILFKFSQLREHFSI
FYVVSVYSNGQPSAALPPMNDAVTVVYDHIGGERGSPFDWKAFSPFQHNN
WMLGGGVNLWNIKEGISLLSPRGIDVSSGVECPGILRKDIFLMQALINSA
KELSSSTL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGGTGAAAATTTGTGGTATTACGCATCCTGATGATGCTCGGGAAGC
TGCCAAAGCGGGAGCCGATTACATTGGCATGATTTTTGCTAAAGATTCTC
GAAGATGTGTGAGTGAAGAAAAAGCAAAGTATATCGTAGAGGCTATACAG
GAAGGGAATTCGGAACCTGTTGGAGTATTCCCAGAGCATTCAGTAGAAGA
AATTTTAGCTATTACTGAGACGACAGGGATTACCAGTATCCAGTTGTCTG
GAGAGGATATTCTATTCAAATTTTCTCAGTTACGAGAGCATTTTTCTATT
TTCTATGTTGTATCCGTTTATTCTAATGGGCAGCCCTCTGCAGCACTGCC
CCCAATGAACGATGCAGTAACTGTTGTATACGACCACATTGGCGGAGAAA
GAGGCTCTCCTTTTGATTGGAAAGCATTCTCTCCTTTTCAACATAATAAT
TGGATGTTGGGTGGAGGAGTCAACCTTTGGAATATCAAAGAAGGTATCAG
TCTTCTCAGTCCCAGGGGAATTGATGTGTCTTCTGGGGTAGAGTGCCCAG
GCATTTTGCGCAAAGATATTTTTTTGATGCAGGCATTGATAAACTCAGCT
AAGGAACTGTCGAGTTCAACACTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy