Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR256 IGR257 IGR255 IGR258 IGR254 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 rpoC, - CT314 CT311 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 rpoC, - CT314 CT311 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 rpoC, - CT314 CT309 CT309 CT311
* Calculated from Protein Sequence

Gene ID: CT312

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (possible ferredoxin)

Gene Start:
349347

Gene Stop:
348979

Gene Length:
369

Molecular Weight*:
13784

pI*:
5.89

Net Charge*:
-1.25

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
See CT059.

Blast Summary:  PSI-Blast Search
CT312 is orthologously related to CPn0084:
residues 5-120 are 52% similar to residues
8-123 of CPn0084. No similarities to T. pallidum or
M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
Residues 8-25 are similar to block PR00678I, concerned with PI3 kinase 85 signatures, e.g.
P85A_BOVIN. Residues 4-15 and 25-36 are similar to block PR00352A, consisting
of ferredoxin signatures, e.g. FER_BACST.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
None.

Gene Protein Sequence:
MEKKKQALCFSCPYCCDGNVAFSVIDLENCLACDCCEASFMFDAEMCDAI
RRFSALCLRIYEAKALLGEAAVSVSVQGQSIDVPFQLLFSRFPVFLNLNL
AGKLVRVRFMFDSLRGEVLYHRG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAAAGAAACAGGCGTTATGTTTTTCTTGTCCATATTGTTGTGA
CGGGAACGTAGCGTTTTCTGTAATTGATTTAGAAAATTGTCTTGCGTGTG
ATTGCTGTGAAGCTTCATTTATGTTTGATGCGGAGATGTGTGATGCTATT
AGACGATTCTCTGCTCTTTGTTTGAGAATTTATGAAGCTAAGGCTCTCCT
CGGGGAGGCTGCAGTCTCGGTCTCTGTTCAAGGCCAAAGTATTGACGTTC
CTTTTCAGCTGCTATTTTCTCGATTCCCTGTCTTTTTGAATTTGAATCTA
GCGGGTAAGCTTGTGCGAGTTAGATTTATGTTCGATTCTTTGCGAGGAGA
AGTCTTGTATCATAGAGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy