Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR256 IGR257 IGR255 IGR258 IGR254 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 rpoC, - CT314 CT311 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 rpoC, - CT314 CT311 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 rpoC, - CT314 CT309 CT309 CT311
* Calculated from Protein Sequence

Gene ID: CT311

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)

Gene Start:
348258

Gene Stop:
348965

Gene Length:
708

Molecular Weight*:
26296

pI*:
9.75

Net Charge*:
7.54

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.

Blast Summary:  PSI-Blast Search
CT311 is orthologously related to CPn0085: residues 1-234 of CT311 are 53% similar to residues 1-244 of CPn0085, a predicted Chlamydia-specific hypothetical protein (basic) from C. pneumoniae. No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
20

PDB Hit:
None.

Gene Protein Sequence:
MKRVILCSLLFASLPIVSKAAVEGKPLSRAAQLRERRKDLHVSGKPSPRY
ALKKRALEAKKNKPSISWITYSNSTYSFLIPNTWQCIDDKTQLPEKLDVL
FIGKGAGGLTPTINSAHEIIHKTEDAYIEEILDYHRTNENTLESSIFAHI
QAHSSNFTIIKTEKNTPWGRVFCLQGVTVIDHTAYVLTSTSTIDDYPNVS
LALLKAASSFRLSEKEEAARGDAILEKALKDLQNGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAGTTATCCTCTGCTCTCTTTTATTTGCAAGTCTCCCTATAGT
TTCGAAGGCAGCCGTAGAAGGAAAGCCTCTTTCTAGAGCTGCTCAATTAC
GAGAAAGAAGAAAAGATCTCCATGTATCAGGGAAGCCCTCTCCTCGTTAT
GCTTTGAAAAAACGTGCTTTAGAAGCTAAAAAAAATAAGCCTTCTATTAG
CTGGATAACCTATTCCAATTCTACCTATTCCTTTCTTATCCCTAATACTT
GGCAGTGCATCGATGATAAAACGCAGCTACCAGAAAAATTAGATGTTCTT
TTCATTGGGAAGGGAGCAGGAGGACTGACGCCAACAATCAACAGCGCACA
CGAAATCATCCATAAAACTGAAGATGCCTATATTGAGGAGATTTTAGACT
ATCATCGCACGAATGAAAACACACTGGAATCTTCTATCTTTGCGCACATT
CAAGCTCACAGCAGCAATTTTACAATTATCAAAACGGAAAAAAACACCCC
TTGGGGACGAGTCTTTTGCCTCCAAGGTGTGACAGTCATTGATCACACAG
CCTACGTCCTTACAAGCACGTCTACCATAGATGACTATCCCAACGTCTCC
TTAGCTCTTCTAAAAGCAGCCTCCTCCTTTAGACTCTCAGAAAAAGAAGA
AGCTGCTCGTGGTGATGCCATTTTAGAAAAAGCTTTGAAAGATCTGCAAA
ATGGAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy