Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR253 IGR252 IGR256 IGR257 IGR255 IGR258 IGR254 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 rpoC, - CT314 CT311 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 rpoC, - CT314 CT311 CT312 atpE, - CT310 tal, - CT313 atpB, - CT307 atpA, - CT308 atpI,ntpI, - CT305 rpoC, - CT314 atpD, - CT306 CT309 atpD, - CT306 CT309 CT311
* Calculated from Protein Sequence

Gene ID: CT309

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (possibly related to V-ATP synthase)

Gene Start:
347356

Gene Stop:
346559

Gene Length:
798

Molecular Weight*:
32002

pI*:
5.03

Net Charge*:
-7.83

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Chlamydia-specific hypothetical protein.
Coding sequences CT304, CT305, CT306, CT307, CT308, and CT310 are concerned with V-type ATP synthase.

Blast Summary:  PSI-Blast Search
CT309 is orthologously related to CPn0087: residues 1-266 of CT309 are 60% similar to residues 1-266 of CPn0087, a predicted Chlamydia-specific hypothetical protein
(possibly related to V-ATP synthase) from C. pneumoniae. No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
None.

Gene Protein Sequence:
MNQCYFLSSFLSPQQPESPPLYSFQEINDLLALNFTDKDWQSYVILRRFF
DLENFAFFWAGKSIPFSFGTITNSNVESLLRLQMWSDEWEFEDFFKDFLL
RYKTPQERLTHFSELVRDFLDHYQDYPSEFLRTYFRFKQDLRIILAGFRA
RVMQKDVSFVLRDEDSSNPIVLHVLMQKDSPNYELPDEFFELRDVLGDYG
RLPHMLNQTLSFYEFHKVEEMSRDKYLNTDAILSRLTTYLMAIRSSWASV
QKGKELINLMEKGIRW

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAGTGTTATTTTTTATCTTCCTTCCTTTCTCCTCAACAACCCGA
ATCTCCTCCTCTCTATTCATTTCAAGAAATCAATGATTTATTAGCGCTAA
ACTTTACAGATAAGGATTGGCAGTCCTACGTAATATTGCGGCGTTTTTTT
GATTTAGAAAATTTTGCTTTTTTCTGGGCAGGGAAATCGATTCCCTTTTC
TTTTGGGACCATTACAAATAGTAATGTAGAGTCTTTGTTGCGGCTTCAAA
TGTGGTCGGATGAGTGGGAGTTTGAAGATTTTTTTAAAGATTTTCTGTTG
CGCTATAAAACTCCTCAGGAGCGTTTAACTCATTTCTCAGAGTTAGTTAG
AGATTTTCTCGATCACTATCAAGATTATCCTTCAGAATTTCTTAGAACCT
ATTTTCGCTTTAAGCAAGATTTACGAATTATTTTGGCAGGGTTTCGAGCT
AGAGTAATGCAGAAAGATGTGTCTTTTGTCCTTAGGGATGAAGATAGTTC
GAATCCCATTGTCTTGCATGTGTTGATGCAAAAAGATTCTCCTAATTATG
AGCTTCCTGATGAATTCTTCGAATTGAGAGATGTTTTAGGAGATTACGGG
CGTCTTCCGCACATGTTGAATCAGACTCTCTCTTTCTATGAATTTCATAA
GGTAGAAGAGATGTCACGAGACAAATACTTGAACACAGATGCAATTCTTT
CTCGGTTAACTACATATTTAATGGCCATTCGTAGTAGTTGGGCGAGTGTT
CAGAAGGGGAAAGAACTGATTAATTTGATGGAGAAAGGAATCAGATGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy